VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GNA1030

Gene Name GNA1030
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010983
NCBI Gene ID 903167
NCBI Protein GI 15676917
Locus Tag NMB1030
Genbank Accession AE002098
Protein Accession NP_274064
Taxonomy ID 122586
Gene Starting Position 1045039
Gene Ending Position 1045602
Gene Strand (Orientation) -
Protein Name hypothetical protein
Protein pI 8.65
Protein Weight 19439.53
Protein Length 187
Protein Note identified by similarity to EGAD:89838; match to protein family HMM PF04264
DNA Sequence
>NC_003112.2:1045039-1045602 Neisseria meningitidis MC58 chromosome, complete genome
TTTATTGTTTGGCTGCCTCGATTTGGATGTCGATGCGGACGCTTTTGGTCATACCAACGTTAACGAGGTA
GTCCATGCCCCATTTGGTGCGGTCGATGGTGGTGCTGAAGTCGCCGCCACAAACTTCGGTTTTCTCCATC
GGGCTTTGGTAGCAGTTGAATTTTTCGGCTTTGAGTTTGACGGGGGCGGTTTTGCCGTGCATGGTCAGGT
TGCCGTCAACGGAAACCAGTTTTTTGCCGTTGAAGTTGAATTTGGTGGAAACAAAGCGGATGTCCGGATA
TTGGGCGGCATCGAAGATGTCGGCTGATTTCAGGTGGTCGGTAAAGTGTTGCGAACCGCTTTGCAGGTTG
GCAATGGGGATGGTGATGTCGATTTTACCGTCGCGTTTTGCTTGGTCGAACTCGACGGAACCGGTCAGAC
CGTAAAAACCGCCGACGTTGGTGCTGGTGTTGAAATGGTCGATGGCGAAACGGGCGTTGGCGTGATATTC
GTCCACTTTGTAGGTGGCGGCGGAGGCAGTACTGATGGCGGCGGCTGCGAGTGCGGCGAAGATGATTTTT
TTCA

Protein Sequence
>NP_274064.1 hypothetical protein NMB1030 [Neisseria meningitidis MC58]
MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIP
IANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAPVKLKAEKFNCYQ
SPMEKTEVCGGDFSTTIDRTKWGMDYLVNVGMTKSVRIDIQIEAAKQ

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen as shown in some assays (Giuliani et al., 2006)
References