VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ipaB

Gene Name ipaB
Sequence Strain (Species/Organism) Shigella flexneri 2a
VO ID VO_0010994
NCBI Protein GI 22036246
Other Database IDs CDD:293143
Taxonomy ID 42897
Gene Strand (Orientation) ?
Protein Name IpaB
Protein pI 7.76
Protein Weight 33839.83
Protein Length 371
Protein Note Type III cell invasion protein SipB; pfam16535
Protein Sequence
>AAM89543.1 IpaB, partial (plasmid) [Shigella flexneri 2a]
MHNVSTTTTGFPLAKILASTELGDNTIQAANDAANKLFSLTIADLTANKNINTTNAHSTSNILIPELKAP
KSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQ
INKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKL
TDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQE
SRKTEMERKSDEYAAEVRKAEELNGV

Molecule Role Protective antigen
Molecule Role Annotation The invasiveness and virulence of Shigella spp. are largely due to the expression of plasmid-encoded virulence factors, among which are the invasion plasmid antigens (IpaB, IpaC, and IpaD). Recent observations have indicated that the Ipa proteins (IpaB, IpaC, and possibly IpaD) form a multiprotein complex capable of inducing the phagocytic event which internalizes the bacterium. Researchers isolated a complex of invasins and LPS from water-extractable antigens of virulent shigellae. Western blot analysis of the complex indicates that all of the major virulence antigens of Shigella, including IpaB, IpaC, and IpaD, and LPS are components of this macromolecular complex. Guinea pigs (keratoconjunctivitis model) or mice (lethal lung model) immunized intranasally with purivied invasin complex (invaplex) on days 0, 14, and 28 and challenged 3 weeks later with virulent shigellae were protected from disease (P<0.01 for both animal models) (Turbyfill et al., 2000).
Related Vaccines(s) S. flexneri Invaplex 24 Subunit Vaccine , S. flexneri Invaplex 50 Subunit Vaccine
References