VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

YPMT1.84 (F1 capsule antigen)

Gene Name YPMT1.84 (F1 capsule antigen)
Sequence Strain (Species/Organism) Yersinia pestis CO92
VO ID VO_0011004
NCBI Gene ID 1172839
NCBI Protein GI 16082876
Locus Tag YPMT1.84
Genbank Accession AL117211
Protein Accession NP_395430
Taxonomy ID 214092
Plasmid No pMT1
Gene Starting Position 85949
Gene Ending Position 86461
Gene Strand (Orientation) +
Protein Name F1 capsule antigen
Protein pI 4.63
Protein Weight 16375.93
Protein Length 170
DNA Sequence
>NC_003134.1:85949-86461 Yersinia pestis CO92 plasmid pMT1, complete sequence
TATGAAAAAAATCAGTTCCGTTATCGCCATTGCATTATTTGGAACTATTGCAACTGCTAATGCGGCAGAT
TTAACTGCAAGCACCACTGCAACGGCAACTCTTGTTGAACCAGCCCGCATCACTCTTACATATAAGGAAG
GCGCTCCAATTACAATTATGGACAATGGAAACATCGATACAGAATTACTTGTTGGTACGCTTACTCTTGG
CGGCTATAAAACAGGAACCACTAGCACATCTGTTAACTTTACAGATGCCGCGGGTGATCCCATGTACTTA
ACATTTACTTCTCAGGATGGAAATAACCACCAATTCACTACAAAAGTGATTGGCAAGGATTCTAGAGATT
TTGATATCTCTCCTAAGGTAAACGGTGAGAACCTTGTGGGGGATGACGTCGTCTTGGCTACGGGCAGCCA
GGATTTCTTTGTTCGCTCAATTGGTTCCAAAGGCGGTAAACTTGCAGCAGGTAAATACACTGATGCTGTA
ACCGTAACCGTATCTAACCAATA

Protein Sequence
>NP_395430.1 F1 capsule antigen (plasmid) [Yersinia pestis CO92]
MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLG
GYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQ
DFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Molecule Role Protective antigen
Molecule Role Annotation Intranasal immunization with flagellin and the F1 antigen was protective against intranasal challenge with virulent Y. pestis CO92, with 93 to 100% survival of immunized mice. Lastly, vaccination of cynomolgus monkeys with flagellin and a fusion of the F1 and V antigens of Y. pestis induced a robust antigen-specific IgG antibody response (Honko et al., 2006).
Related Vaccines(s) Y. pestis F1 antigen Vaccine with Flagellin
References