VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Psn

Gene Name Psn
Sequence Strain (Species/Organism) Yersinia pestis KIM10+
VO ID VO_0011014
NCBI Gene ID 1147351
NCBI Protein GI 22126288
Locus Tag y2404
Genbank Accession AE009952
Protein Accession NP_669711
Taxonomy ID 187410
Gene Starting Position 2673936
Gene Ending Position 2675957
Gene Strand (Orientation) +
Protein Name pesticin/yersiniabactin outer membrane receptor
Protein pI 5.55
Protein Weight 69316.49
Protein Length 673
Protein Note residues 1 to 673 of 673 are 100.00 pct identical to residues 1 to 673 of 673 from GenPept : >gb|AAC69592.1| (AF091251) Ybt/pesticin receptor Psn [Yersinia pestis]
DNA Sequence
>NC_004088.1:2673936-2675957 Yersinia pestis KIM10+, complete genome
AATGAAAATGACACGGCTTTATCCTCTGGCCTTGGGGGGATTATTGCTCCCCGCCATTGCTAATGCCCAG
ACTTCACAGCAAGACGAAAGCACGCTGGTGGTTACCGCCAGTAAACAATCTTCCCGCTCGGCATCAGCCA
ACAACGTCTCGTCTACTGTTGTCAGCGCGCCGGAATTAAGCGACGCCGGCGTCACCGCCAGCGACAAACT
CCCCAGAGTCTTGCCCGGGCTCAATATTGAAAATAGCGGCAACATGCTTTTTTCGACGATCTCGCTACGC
GGCGTCTCTTCAGCGCAGGACTTCTATAACCCCGCCGTCACCCTGTATGTCGATGGCGTCCCTCAGCTTT
CCACCAACACCATCCAGGCGCTTACCGATGTGCAAAGCGTGGAGTTGCTGCGAGGCCCACAGGGAACGTT
ATATGGCAAAAGCGCTCAGGGCGGGATCATCAACATCGTCACCCAGCAGCCGGACAGCACGCCGCGCGGC
TATATTGAAGGCGGCGTCAGTAGCCGCGACAGTTATCGAAGTAAGTTCAACCTGAGCGGCCCCATTCAGG
ATGGCCTGCTGTACGGCAGCGTCACCCTGTTACGCCAGGTTGATGACGGCGACATGATTAACCCCGCGAC
GGGAAGCGATGACTTAGGCGGCACCCGCGCCAGCATAGGGAATGTGAAACTGCGTCTGGCGCCGGACGAT
CAGCCCTGGGAAATGGGCTTTGCCGCCTCACGCGAATGTACCCGCGCCACCCAGGACGCCTATGTGGGAT
GGAATGATATTAAGGGCCGTAAGCTGTCGATCAGCGATGGTTCACCAGACCCGTACATGCGGCGCTGCAC
TGACAGCCAGACCCTGAGTGGGAAATACACCACCGATGACTGGGTTTTCAACCTGATCAGCGCCTGGCAG
CAGCAGCATTATTCGCGCACCTTCCCTTCCGGTTCGTTAATCGTCAATATGCCTCAGCGCTGGAATCAGG
ATGTGCAGGAGCTGCGCGCCGCAACCCTGGGCGATGCGCGTACCGTTGATATGGTGTTTGGGCTGTACCG
GCAGAACACCCGCGAGAAGTTAAATTCAGCCTACGACATGCCGACAATGCCTTATTTAAGCAGTACCGGC
TATACCACCGCTGAAACGCTGGCCGCATACAGTGACCTGACCTGGCATTTAACCGATCGTTTTGATATCG
GCGGCGGCGTGCGCTTCTCGCATGATAAATCCAGTACACAATATCACGGCAGCATGCTCGGCAACCCGTT
TGGCGACCAGGGTAAGAGCAATGACGATCAGGTGCTCGGGCAGCTATCCGCAGGCTATATGCTGACCGAT
GACTGGAGAGTGTATACCCGTGTAGCCCAGGGATATAAACCTTCCGGGTACAACATCGTGCCTACTGCGG
GTCTTGATGCCAAACCGTTCGTCGCCGAGAAATCCATCAACTATGAACTTGGCACCCGCTACGAAACCGC
TGACGTCACGCTGCAAGCCGCGACGTTTTATACCCACACCAAAGACATGCAGCTTTACTCTGGCCCGGTC
AGGATGCAGACATTAAGCAATGCGGGTAAAGCCGACGCCACCGGCGTTGAGCTTGAAGCGAAGTGGCGGT
TTGCGCCAGGCTGGTCATGGGATATCAATGGCAACGTGATCCGTTCCGAATTCACCAATGACAGTGAGTT
GTATCACGGTAACCGGGTGCCGTTCGTACCACGTTATGGCGCGGGAAGCAGCGTGAACGGCGTGATTGAT
ACGCGCTATGGCGCACTGATGCCCCGACTGGCGGTTAATCTGGTCGGGCCGCATTATTTCGATGGCGACA
ACCAGTTGCGGCAAGGCACCTATGCCACCCTGGACAGCAGCCTGGGCTGGCAGGCGACTGAACGGATGAA
CATTTCCGTCTATGTCGATAACCTGTTCGACCGTCGTTACCGTACCTATGGCTACATGAACGGCAGCAGC
GCCGTCGCGCAGGTCAATATGGGTCGCACCGTCGGTATCAATACGCGAATTGATTTCTTCTG

Protein Sequence
>NP_669711.1 pesticin/yersiniabactin outer membrane receptor [Yersinia pestis KIM10+]
MKMTRLYPLALGGLLLPAIANAQTSQQDESTLVVTASKQSSRSASANNVSSTVVSAPELSDAGVTASDKL
PRVLPGLNIENSGNMLFSTISLRGVSSAQDFYNPAVTLYVDGVPQLSTNTIQALTDVQSVELLRGPQGTL
YGKSAQGGIINIVTQQPDSTPRGYIEGGVSSRDSYRSKFNLSGPIQDGLLYGSVTLLRQVDDGDMINPAT
GSDDLGGTRASIGNVKLRLAPDDQPWEMGFAASRECTRATQDAYVGWNDIKGRKLSISDGSPDPYMRRCT
DSQTLSGKYTTDDWVFNLISAWQQQHYSRTFPSGSLIVNMPQRWNQDVQELRAATLGDARTVDMVFGLYR
QNTREKLNSAYDMPTMPYLSSTGYTTAETLAAYSDLTWHLTDRFDIGGGVRFSHDKSSTQYHGSMLGNPF
GDQGKSNDDQVLGQLSAGYMLTDDWRVYTRVAQGYKPSGYNIVPTAGLDAKPFVAEKSINYELGTRYETA
DVTLQAATFYTHTKDMQLYSGPVRMQTLSNAGKADATGVELEAKWRFAPGWSWDINGNVIRSEFTNDSEL
YHGNRVPFVPRYGAGSSVNGVIDTRYGALMPRLAVNLVGPHYFDGDNQLRQGTYATLDSSLGWQATERMN
ISVYVDNLFDRRYRTYGYMNGSSAVAQVNMGRTVGINTRIDFF

Molecule Role Protective antigen
Molecule Role Annotation Study tested the efficacy of 2 proteins, Psn and a portion of LcrV in protecting mice against virulent Yersinia pestis challenge. Results show that the truncated LcrV protein delivered by RASV is sufficient to afford a full protective immune response in a mouse model of bubonic plague and the Psn protein afforded partial protection in a non-optimized system (Branger et al., 2007).
Related Vaccines(s) RASV expressing Y. pestis Psn
References