VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

caf1

Gene Name caf1
Sequence Strain (Species/Organism) Yersinia pestis
VO ID VO_0011017
NCBI Protein GI 48621
Other Database IDs CDD:286355
GOA:P26948
InterPro: IPR008966
InterPro: IPR015335
PDB: 1P5U
PDB: 1P5V
PDB: 1Z9S
PDB: 3DOS
PDB: 3DPB
PDB: 3DSN
UniProtKB/UniProt: P26948
Taxonomy ID 632
Gene Strand (Orientation) ?
Protein Name F1 capsule antigen
Protein pI 4.63
Protein Weight 16931.51
Protein Length 223
Protein Note Caf1 Capsule antigen; pfam09255
Protein Sequence
>CAA43966.1 F1 capsule antigen [Yersinia pestis]
MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLG
GYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQ
DFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Molecule Role Protective antigen
Molecule Role Annotation Vaccination of mice with deF1 DNA conferred protection against subcutaneous infection with the virulent Y. pestis Kimberley53 strain, even at challenge amounts as high as 4,000 50% lethal doses (Grosfeld et al., 2003).
Related Vaccines(s) Y. pestis DNA vaccine encoding dfF1 Protein
References