VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

RPVgp5 F

Gene Name RPVgp5 F
Sequence Strain (Species/Organism) Rinderpest virus (strain Kabete O)
NCBI Gene ID 3021776
NCBI Protein GI 56410434
Locus Tag RPVgp5
Genbank Accession X98291
Protein Accession YP_087124
Taxonomy ID 11242
Gene Starting Position 5457
Gene Ending Position 7097
Gene Strand (Orientation) +
Protein Name F protein
Protein pI 8.22
Protein Weight 55061.12
Protein Length 546
DNA Sequence
>NC_006296.2:5457-7097 Rinderpest virus (strain Kabete O), complete genome
CATGAAGATCTTATTTGCTACCCTGCTAGTAGTGACCACCCCTCACTTAGTCACTGGCCAGATCCACTGG
GGCAATCTTTCGAAAATTGGAGTCGTAGGGACGGGTAGTGCTAGTTACAAGGTGATGACCCAATCGAGTC
ACCAGACACTAGTTATAAAGCTGATGCCCAATATCACCGCTATAGACAACTGCACTAAGACTGAGATTGA
GGAGTATAAGAGGCTGTTGGGGACAGTGCTTCAGCCTATTAAGGTCGCTCTGAACGCCATTACTAAGAAT
ATAAAACCAATCAGGAGTTCCACTACCAGTAGGAGACACAGAAGGTTCGCAGGGGTCGCTTTGGCTGGTG
CAGCTCTCGGAGTTGCAACCGCAGCCCAGATTACAGCAGGGATTGCTCTTCATCAATCAATGATGAATAC
CCAGGCTATTGAAAGTCTTAAGGCAAGTCTGGAAACAACTAATCAAGCAATTGAGGAAATACGACAAGCA
GGCCAAGAAATGATCCTAGCAGTTCAAGGTGTCCAGGACTACATCAACAATGAACTGGTACCTGCAATGG
GCCAATTATCGTGTGATATCGTGGGTCAGAAGCTAGGGCTGAAACTGCTCAGATACTACACTGAAATATT
ATCATTATTTGGCCCCAGCCTCAGAGACCCAATTTCGGCCGAGATTTCTATCCAGGCTTTGAGTTACGCC
TTAGGTGGGGACATAAACAAAATACTAGAAAAGCTAGGGTATAGCGGGAGTGATCTCCTTGCTATACTGG
AAAGTAAAGGTATCAAAGCTAAGATAACCTATGTGGATATCGAAAGTTACTTCATTGTGCTCAGCATTGC
CTATCCTTCGCTTTCTGAAATTAAAGGGGTGATAATTCATCGCCTGGAGGGTGTCTCTTACAATATAGGG
TCGCAGGAGTGGTATACCACAGTACCTCGATATGTGGCAACCCAAGGTTACCTCATTTCGAATTTCGATG
ACACACCCTGTGCATTCTCCCCAGAGGGCACTATCTGCAGCCAGAATGCATTATACCCAATGAGCCCACT
CCTCCAGGAATGTTTCCGTGGGTCAACCAGGTCATGCGCTCGTACACTGGTCTCTGGGTCTATAGGGAAT
AGGTTTATCCTATCCAAGGGGAACCTCATTGCCAACTGTGCCTCAATCTTGTGCAAGTGTTACACCACTG
GCTCAATAATAAGTCAAGATCCTGACAAGATCCTAACATATATAGCTGCAGACCAATGCCCCATCGTAGA
AGTGGACGGTGTAACCATCCAGGTTGGGAGCAGAGAGTACCCTGATGCAGTGTACCTGCATAAAATAGAC
CTTGGCCCACCAATATCGCTGGAGAAGCTAGATGTTGGGACTAACCTCGGCAATGCAGTGACAAAACTGG
AGAAAGCCAAGGATCTACTAGATTCATCTGATCTGATCCTGGAAACCATCAAGGGTGCTTCAGTCACGAA
CACAGGCCATATTCTAGTTGGAGCCGGGTTGATTGCAGTAGTGGGTATCCTCATTGTTACCTGTTGCTGT
AGGAAGCGCAGTAATGACAGCAAAGTGTCCACTGTGATATTGAATCCGGGTCTTAAACCAGACCTCACTG
GTACATCCAAATCCTACGTACGGTCACTGTA

Protein Sequence
>YP_087124.2 F protein [Rinderpest virus (strain Kabete O)]
MKILFATLLVVTTPHLVTGQIHWGNLSKIGVVGTGSASYKVMTQSSHQTLVIKLMPNITAIDNCTKTEIE
EYKRLLGTVLQPIKVALNAITKNIKPIRSSTTSRRHRRFAGVALAGAALGVATAAQITAGIALHQSMMNT
QAIESLKASLETTNQAIEEIRQAGQEMILAVQGVQDYINNELVPAMGQLSCDIVGQKLGLKLLRYYTEIL
SLFGPSLRDPISAEISIQALSYALGGDINKILEKLGYSGSDLLAILESKGIKAKITYVDIESYFIVLSIA
YPSLSEIKGVIIHRLEGVSYNIGSQEWYTTVPRYVATQGYLISNFDDTPCAFSPEGTICSQNALYPMSPL
LQECFRGSTRSCARTLVSGSIGNRFILSKGNLIANCASILCKCYTTGSIISQDPDKILTYIAADQCPIVE
VDGVTIQVGSREYPDAVYLHKIDLGPPISLEKLDVGTNLGNAVTKLEKAKDLLDSSDLILETIKGASVTN
TGHILVGAGLIAVVGILIVTCCCRKRSNDSKVSTVILNPGLKPDLTGTSKSYVRSL

Molecule Role Protective antigen
Related Vaccines(s) v2RVFH
References