VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

peb1A

Gene Name peb1A
Sequence Strain (Species/Organism) Campylobacter jejuni
VO ID VO_0011045
NCBI Protein GI 112360246
3D structure: PDB ID 2V25
Other Database IDs CDD:183381
EnsemblGenomes-Gn:Cj0921c
EnsemblGenomes-Tr:CAL35041
GOA:Q0P9X8
InterPro: IPR001638
InterPro: IPR018313
PDB: 2V25
Taxonomy ID 192222
Gene Strand (Orientation) ?
Protein Name aspartate/glutamate-binding ABC transporter protein
Protein pI 8.53
Protein Weight 27458.45
Protein Length 390
Protein Note bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed
Protein Sequence
>CAL35041.1 aspartate/glutamate-binding ABC transporter protein [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]
MVFRKSLLKLAVFALGACVAFSNANAAEGKLESIKSKGQLIVGVKNDVPHYALLDQATGEIKGFEVDVAK
LLAKSILGDDKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLVLKEKKY
KSLADMKGANIGVAQAATTKKAIGEAAKKIGIDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDD
KSEILPDSFEPQSYGIVTKKDDPAFAKYVDDFVKEHKNEIDALAKKWGL

Molecule Role Protective antigen
Molecule Role Annotation Chitosan-DNA vaccines were prepared by embedding pcDNA3.1(+)-cadF and pcDNA3.1(+)-peblA with chitosan respectively. The mice immunized with chitosan-DNA vaccines have generated high levels of IgA and IgG from the sera and IgA from the intestinal secretions and the P/N value went up to 20.58, 30.13 and 6.87 respectively. The chitosan-DNA vaccines induced strongest level of protection in BALB/c mice against challenge with C. jejuni HS:19 strain and the protective efficacies was 93.70 (Zheng et al., 2007).
Related Vaccines(s) C. jejuni DNA vaccine pcDNA3.1(+)-peblA
References