VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fspA1

Gene Name fspA1
Sequence Strain (Species/Organism) Campylobacter jejuni
VO ID VO_0011047
NCBI Protein GI 116292649
Other Database IDs CDD:330552
Taxonomy ID 197
Gene Strand (Orientation) -
Protein Name FspA1
Protein pI 4.34
Protein Weight 15410.38
Protein Length 187
Protein Note exonuclease subunit SbcC; Provisional; cl25731
Protein Sequence
>ABJ97640.1 FspA1 [Campylobacter jejuni]
MQINNSLNSLSQYVKVNSNEENQNSKNQEQNALAQDPAVEVNISKEAKEKSNASNQNNSQAPAQALNAQN
NTQQDSSSNSEDKLTELTQKLAEIQAKIVELTAKMSKANEDQIKSIESQIATLNAQASTIQAQIQELQSQ
QA

Molecule Role Protective antigen
Molecule Role Annotation Immunogenicity and protective efficacy of three Campylobacter jejuni flagellum-secreted proteins, FlaC, FspA1, and FspA2, were compared by use of a mouse model. Immunization with FspA1 resulted in 57.8% protection without adjuvant or 63.8% protection with adjuvant against homologous challenge with 81-176 (Baqar et al., 2008).
Related Vaccines(s) C. jejuni FspA1 protein vaccine
References