VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Env/Rex/Tax

Gene Name Env/Rex/Tax
Sequence Strain (Species/Organism) Bovine leukemia virus
VO ID VO_0011051
NCBI Gene ID 2760849
NCBI Protein GI 9626230
Locus Tag BLVgp05
Genbank Accession AF033818
Protein Accession NP_056898
Taxonomy ID 11901
Gene Starting Position 4614
Gene Ending Position 7460
Gene Strand (Orientation) +
Protein Name p18
Protein pI 10.96
Protein Weight 16183.28
Protein Length 156
DNA Sequence
>NC_001414.1:4614-7460 Bovine leukemia virus, complete genome
AATGCCCAAAGAACGACGGTCCCGAAGACGCCCACAACCGATCATCAGATGGGTAAGTCTCACTCTTACT
CTCCTCGCTCTCTGTCAGCCCATCCAGACTTGGAGATGCTCCCTGTCCCTAGGAAATCAACAATGGATGA
CAACATATAACCAAGAGGCAAAATTTTCCATCTCCATTGACCAAATATTAGAGGCTCACAATCAATCACC
TTTCTGTCCCAGGTCTCCCAGATACACCTTGGACTTCGTAAATGGTTATCCTAAGATCTATTGGCCCCCC
CCACAAGGGCGGCGCCGGTTTGGAGCCAGGGCCATGGTCACATATGATTGCGAGCCCCGATGCCCTTATG
TGGGGGCAGATCACTTCGACTGCCCCCACTGGGACAATGCCTCCCAGGCCGATCAAGGGTCCTTTTATGT
CAATCATCAGATTTTATTCCTGCATCTCAAACAATGTCATGGAATTTTCACTCTAACCTGGGAAATATGG
GGATATGATCCCCTGATCACCTTTTCTTTACATAAAATTCCTGATCCCCCTCAACCCGACTTCCCTCAGC
TGAACAGTGACTGGGTTCCCTCTGTCAGATCATGGGCCCTGCTTTTAAATCAAACGGCACGGGCCTTCCC
AGACTGTGCTATATGTTGGGAACCTTCCCCTCCCTGGGCTCCCGAAATATTAGTATATAACAAAACCATC
TCCGGCTCTGGACCCGGTCTCGCCCTCCCGGACGCCCAAATCTTCTGGGTCAACACGTCCTTGTTTAACA
CCACCCAAGGATGGCACCACCCTTCCCAGAGGTTGTTGTTCAATGTTTCTCAAGGCAACGCCTTATTATT
ACCCCCTATCTCCCTGGTTAATCTCTCTACGGTTTCCTCCGCCCCTCCTACCCGGGTCAGACGCAGTCCC
GTCGCAGCCCTGACCTTAGGCCTAGCCCTGTCAGTGGGGCTCACTGGAATTAATGTAGCCGTGTCTGCCC
TTAGCCATCAGAGACTCACCTCCCTGATCCACGTTCTGGAGCAAGATCAGCAACGCTTGATCACAGCAAT
TAACCAGACCCATTATAATTTGCTTAATGTGGCCTCTGTGGTCGCCCAGAACCGACGGGGGCTTGATTGG
TTGTACATCCGGCTGGGTTTTCAAAGCCTATGTCCCACAATCAATGAACCTTGCTGTTTCCTACGCATTC
AAAATGACTCCATTATCCGCCTCGGTGATCTCCAGCCTCTCTCGCAAAGAGTCTCTACAGACTGGCAGTG
GCCCTGGAATTGGGATCTGGGGCTCACCGCCTGGGTGCGAGAAACCATTCATTCTGTTCTAAGCCTATTC
CTATTAGCCCTTTTTTTGCTCTTCTTGGCCCCCTGCCTGATAAAATGCTTGACCTCTCGCCTTTTAAAAC
TCCTCCGGCAGGCTCCCCACTTCCCTGAAATCTCCTTCCCCCCTAAACCCGATTCTGATTATCAGGCCTT
GCTACCGTCAGCACCAGAGATCTACTCTCACCTCTCCCCCACCAAACCCGATTACATCAACCTTCGACCC
TGCCCTTGACACCCCCGTGTTTCACGCACCCTCAGGCTGTGGTGGGGCACTGGCTTAGTGGAATAGTCAG
TGTACCATCACAAGCCTCTTCTTGCTGCCAGCACCGAGTTCGAACACAGCCCTACCCTGAGCCTCTCTGA
GTACATGACTGAGTGTAGCGCAGAGAGGTTGTCGCTTCTGCGTGTCACTCAGTCATTTTTTATAGCCGAT
TGGGGTTCGCGCCCTCCCATTGCCTGTGACACGGTTAAGACCTCTCTCACTTCTGCTTCACCATCCCCCT
GCCAGCGTTGGTCTAGTGGAAAGAACTAACGCTGACGGGGGCGATTTCTTGCAGCTGTGCTAAGCGAGAG
GCTCTGGTGCTGGGGATAAGATGCGGCCCCTAGCACCACAGTCTCTGCGCCTTTTGGGTTCGAATCTTCC
CCATGCAGCTTCCGCTTTTTACGCCCTGTTGCACACCCTTTCTAGAGATACCTGAAAATCTCAGCTCGCA
CCCCAAGGAAGGTTGTGGCTCAGAGGTTAAAATAGCTCGGACCGCAACCTCCCTTTCTTTTTATTCCACC
CTCGCAAGGCCCCGGGTTCTGGGCCCCCTAACGGAGGTTCAGAATTTCCTCTACTAGGGGATGCTCAGGT
CCAAGTGTGCACAATATCTCTTCCAAAAGGTCCTGATGAACATCTTCCCATGTAACAAGCCCCAGCAGAG
ACATTCCAGCCACATCCAGCAGCATTTGGGCCGCCTTCTCTAACAGTGCCCATAAAGTCCCTTCCGTTTC
CACAACGGCTGCCTCTGCATCTTCTATTTCCACCTCGGCACCGACTCCCCCGCCGAGCCCTTCAAGCTCT
TCGGGATCCATTACCTGATAACGACAAAATTATTTCTTGTCTTTTAAGCAAGTGTTGTTGGTTGGGGGCC
CCACTCTCTACATGCCTGCCCGGCCCTGGTTTTGTCCAATGATGTCACCATCGATGCCTGGTGCCCCCTC
TGCGGGCCCCATGAACGACTCCAATTCGAAAGGATCGACACCACGCTCACCTGCGAGACCCACCGTATCA
CCTGGACCGCCGATGGACGACCTTTTGGCCTCAATGGAACATTGTTCCCTCGACTGCATGTCTCCGAGAC
CCGCCCCCAAGGGCCCCGACGACTCTGGATCAACTGCCCCCTTCCGGCCGTTCGCGCTCAGCCCGGCCCG
GTTTCACTTTCCCCCTTCGAGCAGTCCCCCTTCCAGCCCTACCAATGCCAATTGCCCTCGGCCTCTAGCG
ACGGTTGCCCCATCATCGGGCACGGCCTTCTTCCCTGGAACAACTTA

Protein Sequence
>NP_056898.1 p18 [Bovine leukemia virus]
MPKERRSRRRPQPIIRWQVLLVGGPTLYMPARPWFCPMMSPSMPGAPSAGPMNDSNSKGSTPRSPARPTV
SPGPPMDDLLASMEHCSLDCMSPRPAPKGPDDSGSTAPFRPFALSPARFHFPPSSSPPSSPTNANCPRPL
ATVAPSSGTAFFPGTT

Molecule Role Protective antigen
Molecule Role Annotation The bovine leukemia virus (BLV) envelope gene encoding extracellular glycoprotein gp51 (encoded by env gene) and transmembrane glycoprotein gp30 was cloned into a vehicle expression vector under the human cytomegalovirus (CMV) intermediate early promoter. The intramuscular injection of this plasmid vector generated a cellular immune response. Seven out of ten cows vaccinated with the DNA construct resisted a drastic challenge (Brillowska et al., 1999).
Related Vaccines(s) Bovine leukemia virus DNA vaccine encoding Env
References