VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

dnaX

Gene Name dnaX
Sequence Strain (Species/Organism) Chlamydophila abortus
VO ID VO_0011056
NCBI Protein GI 62148024
Other Database IDs CDD:180523
EnsemblGenomes-Gn:CAB327
EnsemblGenomes-Tr:CAH63776
GOA:Q5L6F0
InterPro: IPR003593
InterPro: IPR008921
InterPro: IPR012763
InterPro: IPR027417
UniProtKB/TrEMBL: Q5L6F0
Taxonomy ID 218497
Gene Strand (Orientation) ?
Protein Name DNA polymerase III subunit gamma/tau
Protein pI 6.44
Protein Weight 47941.3
Protein Length 526
Protein Note DNA polymerase III subunits gamma and tau; Validated
Protein Sequence
>CAH63776.1 DNA polymerase III subunit gamma/tau [Chlamydia abortus S26/3]
MTSATYQVSSRKYRPQTFAEMLGQDAVVTVLKNALQFQRVAHAYLFSGIRGTGKTTLARIFAKALNCKEL
TPEHEPCNQCCVCKEISSGTSLDVIEIDGASHRGIEDIRQINETVLFTPAKSQYKIYIIDEVHMLTKEAF
NSLLKTLEEPPSHVKFFLATTENYKIPSTILSRCQKMHLKRIPETMIVDKLASISQAGGIETSREALLPI
ARAAQGSLRDAESLYDYVIGLFPTSLSPELVADALGLLSQDTLATLSECIRTQKYAEALLPVTTAINSGV
APITFLHDLTVFYRDVLLNKDQGNSPLSAIAMHYSSECLLEIIDFLGEAAKHLQQTIFEKTFLETVIIHL
IRICQRPSLETLFSQLKTSTFDTVRNVPQQQEPSKPSIQPEKHYQDQSFLTSPSPTPKVQHQKEASPSLV
GSATIDTLLQFAVVEFSGILTKE

Molecule Role Protective antigen
Molecule Role Annotation Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. DNA pol III Gamma and Tau (CP #1, dnaX) was found to be protective. CP #1 (dnaX) was more protective than the live-vaccine, positive control. (Stemke-Hale et al., 2005).
Related Vaccines(s) C. abortus DNA vaccine encoding DnaX
References