VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pomp90A

Gene Name pomp90A
Sequence Strain (Species/Organism) Chlamydophila abortus
VO ID VO_0011058
NCBI Protein GI 187438939
Other Database IDs CDD:273587
Taxonomy ID 83555
Gene Strand (Orientation) ?
Protein Name polymorphic outer membrane protein 90A
Protein pI 4.63
Protein Weight 35956.31
Protein Length 446
Protein Note Chlamydial polymorphic outer membrane protein repeat; TIGR01376
Protein Sequence
>ACD10929.1 polymorphic outer membrane protein 90A, partial [Chlamydia abortus]
MSNSLSFANDAQTALTPSDSYNGNVTSEEFQVKETSSGTTYTCEGNVCISFAGKDSGLKKSCFSATDNLT
FLGNGYTLCFDNITTTASNPGAINVQGQGKTLGISGFSLFSCAYCPPGTTGYGAIQTKGNTTLKDNSSLV
FHKNCSTAEGGAIQCKGSSDAELKIENNQNLVFSENSSTSKGGAIYADKLTIVSGGPTLFSNNSVSNGSS
PKGGAISIKDSSGECSLTADLGDITFDGNKIIKTSGGSSTVTRNSIDLGTGKFTKLRAKDGFGIFFYDPI
TGGGSDELNINKKETVDYTGKIVFSGEKLSDEEKARAENLASTFNQPITLSAGSLVLKDGVSVTAKQVTQ
EAGSTVVMD

Molecule Role Protective antigen
Molecule Role Annotation Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Protective clone CP #4 (OMP90A, pomp90A) was diluted 1/2000 in a non-protective sublibrary pool of clones. This CP #4-spiked sublibrary conferred protection. Five clones were significantly more protective than the genes encoding fewer than 50 amino acids (CP #1–5 and 7, p-value of less than 0.05 when comparing lung weights). (Stemke-Hale et al., 2005).
Related Vaccines(s) C. abortus DNA vaccine Pomp90A
References