VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

omlA

Gene Name omlA
Sequence Strain (Species/Organism) Chlamydophila abortus
VO ID VO_0011060
NCBI Protein GI 62184824
Other Database IDs CDD:308876
Taxonomy ID 218497
Gene Strand (Orientation) ?
Protein Name outer membrane lipoprotein
Protein pI 8.12
Protein Weight 9011.35
Protein Length 160
Protein Note Chlamydia cysteine-rich outer membrane protein 3; pfam03503
Protein Sequence
>YP_219609.1 outer membrane lipoprotein [Chlamydophila abortus S26/3]
MKKAVLLATVFCGALGLTSCCRIVDCCFEDPCAPKPCNPCGNKKDKGCSPCGTYTPSCSKPCGSECNSGV
QGPQAKGCTSLDGRCKQ

Molecule Role Protective antigen
Molecule Role Annotation Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. CP #7 (omlA) was significantly more protective than the genes encoding fewer than 50 amino acids (p-value of less than 0.05 when comparing lung weights). The chlamydial loads generally tracked with protection and the most protective genes were significantly lower than in unvaccinated controls (p < 0.05 in the Mann–Whitney U-test for genes CP #1, 2, 4–7, 9, 10) (Stemke-Hale et al., 2005).
Related Vaccines(s) C. abortus DNA vaccine encoding OmlA
References