VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

CAB613 putative peptidase

Gene Name CAB613 putative peptidase
Sequence Strain (Species/Organism) Chlamydophila abortus
VO ID VO_0011061
NCBI Protein GI 62185225
Other Database IDs CDD:189015
Taxonomy ID 218497
Gene Strand (Orientation) ?
Protein Name peptidase
Protein pI 6.33
Protein Weight 68106.03
Protein Length 671
Protein Note Peptidase family M3B Oligopeptidase F (PepF); cd09608
Protein Sequence
>YP_220010.1 peptidase [Chlamydophila abortus S26/3]
MSVEFNKQQVRPRSEISPQDCWDITPLYLNRKAWKADLDSFGLKTDGSPTWPALQATQYQLDNSESLLSL
LTTLFSIERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLSA
PCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHAL
ASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYT
NLIDIVKKNSSLITKYFSIKQRCLNLKDFHFYDVYAPLSQSKEKKYTFQEAVDLIYTSLSPLGTEYIDTL
KQGLTTQGWVDKYENLNKRSGAYSSGCYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDA
QYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPL
TEEYLSSTYKNLQNEFYGEIITFDVLSNIEWARIPHFYYNFYVYQYATGIIAALCFLEKILNNEDNALNS
YLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSLI

Molecule Role Protective antigen
Molecule Role Annotation Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Of the 14 individually tested clones, CP #1 through CP #9 had positive relative protection scores. CP #8 (CAB613, Oligopeptidase) was found to confer protection (Stemke-Hale et al., 2005).
Related Vaccines(s) C. abortus DNA vaccine encoding CAB613
References