VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

gatB

Gene Name gatB
Sequence Strain (Species/Organism) Chlamydophila abortus
VO ID VO_0010880
NCBI Protein GI 62147986
Other Database IDs CDD:235489
EnsemblGenomes-Gn:CAB287
EnsemblGenomes-Tr:CAH63737
GOA:Q5L6I8
InterPro: IPR003789
InterPro: IPR004413
InterPro: IPR006075
InterPro: IPR017958
InterPro: IPR017959
InterPro: IPR018027
Taxonomy ID 218497
Gene Strand (Orientation) ?
Protein Name aspartyl/glutamyl-tRNA amidotransferase subunit B
Protein pI 5.67
Protein Weight 51934.12
Protein Length 583
Protein Note aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated; PRK05477
Protein Sequence
>CAH63737.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Chlamydia abortus S26/3]
MSDVYADWESVIGLEVHVELNTKSKLFSCARNRFGDEPNTNISPVCTGMPGSLPVLNKEAVRKAVLFGCA
VEGEVALLSRFDRKSYFYPDSPRNFQITQFEHPIVRGGHIKAIVHGEERHFELAQAHIEDDAGMLKHFGE
FAGVDYNRAGVPLIEIVSKPCMFCADDAVAYATALVSLLDYIGISDCNMEEGSVRFDVNISVRPKGSEEL
RNKVEIKNMNSFAFMAQALEAERCRQIDAYLDNPNADPKTVIPGATYRWDPEKKKTVLMRLKERAEDYKY
FIEPDLPVLQLTEAYIDEIRHTLPELPFNKYQRYLHEYALAEDIAAILISDKHSAHFFELAAQECKNYRA
LSNWLTVEFAGRCKLKGKNLAFSGILPSSVAQLVNFIDQGVITGKIAKDIADMMMESPEKSPETILKENP
EMLPMTDESALVAIISEVITANPQSVVDYKSGKTKALGFLVGQIMKRTQGKAPPNRVNELLLVELSK

Molecule Role Protective antigen
Molecule Role Annotation Genetic immunization was used to functionally test the genes of C. abortus as vaccines in a mouse challenge system. Glu-tRNA Gln Amidotransferase (CP #3, gatB) was found to be protective. Three of the clones (CP #1–3) elicited protection that was statistically higher than the unvaccinated control, which has high variance (Stemke-Hale et al., 2005).

Note: Part of CP #3 also belongs to gatA
Related Vaccines(s) C. abortus DNA vaccine encoding GatA/GatB
References