VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

omp1

Gene Name omp1
Sequence Strain (Species/Organism) Chlamydophila abortus
VO ID VO_0010881
NCBI Protein GI 40601
Other Database IDs CDD:279628
GOA:P16567
InterPro: IPR000604
UniProtKB/UniProt: P16567
Taxonomy ID 83555
Gene Strand (Orientation) ?
Protein Name major outer membrane protein
Protein pI 7.65
Protein Weight 40147.34
Protein Length 457
Protein Note submitted as Chlamydia psittaci;
enzootic abortion
Protein Sequence
>CAA36152.1 major outer membrane protein [Chlamydia abortus]
MKKLLKSALLFAATGSALSLQALPVGNPAEPSLLIDGTMWEGASGDPCDPCSTWCDAISIRAGYYGDYVF
DRVLKVDVNKTITGMGAVPTGTAAANYKTPTDRPNIAYGKHLQDAEWFTNAAFLALNIWDRFDIFCTLGA
SNGYFKASSAAFNLVGLIGVKGSSIAADQLPNVGITQGIVEFYTDTTFSWSVGARGALWECGCATLGAEF
QYAQSNPKIEMLNVVSSPAQFVVHKPRGYKGTAFPLPLTAGTDQATDTKSATIKYHEWQVGLALSYRLNM
LVPYISVNWSRATFDADAIRIAQPKLAAAVLNLTTWNPTLLGEATALDTSNKFADFLQIASIQINKMKSR
KACGVAVGATLIDADKWSITGEARLINERAAHMNAQFRF

Molecule Role Protective antigen
Molecule Role Annotation The MOMP (omp1) DNA immunization induced a non-specific and partial protection in OF1 outbred mice fetuses against challenge with C. abortus (Héchard et al., 2003).
Related Vaccines(s) C. abortus DNA vaccine encoding MOMP
References