VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

dnaK

Gene Name dnaK
Sequence Strain (Species/Organism) Chlamydophila abortus
VO ID VO_0010882
NCBI Protein GI 26006347
Other Database IDs CDD:234715
Taxonomy ID 83555
Gene Strand (Orientation) ?
Protein Name DnaK
Protein pI 4.71
Protein Weight 67356.62
Protein Length 707
Protein Note molecular chaperone DnaK; Provisional; PRK00290
Protein Sequence
>AAN77259.1 DnaK [Chlamydia abortus]
MSEQKKSSKIIGIDLGTTNSCVSVMEGGQAKVIVSSEGTRTTPSIVAFKGNETLVGIPAKRQAVTNPAKT
LASTKRFIGRKYSEVESEIKTVPYQVASGSNGDVVFPIDGKQFTPEEIGAQVLIKMKETAEAYLGEPVTE
AVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKAGDKKIAVFDLGGGTFDISILEIG
DGVFEVLSTNGDTHLGGDDFDEVIIKWMIEEFQKQEGIDLSKDNMALQRLKDAAEKAKIELSGMSSTEIN
QPFITMDANGPKHLTLTLTRAHFEKLASNLIERTKAPCQKALADAKLSASDIDDVLLVGGMSRMPAVQEV
VKSIFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIETLGGVMTPLVERNTTIPTQK
KQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHPQIEVTFDIDANGILHVSAKDAA
SGREQKIRIEASSGLKEDEIQRMINDAEKNKEEDKKRREASDVRNEADSMIFRAEKAISDYKENIPESLT
KEIEERIEKVRSALKEDAPTEKIKEASDELSRHMQKIGEAMQSQSASAAANAQDGPNINTEDLKKHSFST
KPPTGNSSSSANNENIEEADVEIVDKPND

Molecule Role Protective antigen
Molecule Role Annotation In pregnant mice, the dnaK vaccine induced a non-specific partial protection from abortion after challenge with Chlamydophila abortus (Héchard et al., 2002).
Related Vaccines(s) C. abortus DNA vaccine encoding DnaK
References