VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MOMP

Gene Name MOMP
VO ID VO_0010890
NCBI Protein GI 1518659
Other Database IDs CDD:279628
Taxonomy ID 83560
Gene Strand (Orientation) ?
Protein Name major outer membrane protein
Protein pI 4.86
Protein Weight 39872.84
Protein Length 457
Protein Note mouse pneumonitis; submitted as Chlamydia trachomatis
Protein Sequence
>AAB07068.1 major outer membrane protein [Chlamydia muridarum]
MKKLLKSVLAFAVLGSASSLHALPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISLRLGYYGDFVF
DRVLKTDVNKQFEMGAAPTGDADLTTAPTPASRENPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGA
TSGYLKGNSAAFNLVGLFGRDETAVAADDIPNVSLSQAVVELYTDTAFAWSVGARAALWECGCATLGASF
QYAQSKPKVEELNVLCNAAEFTINKPKGYVGQEFPLNIKAGTVSATDTKDASIDYHEWQASLALSYRLNM
FTPYIGVKWSRASFDADTIRIAQPKLETSILKMTTWNPTISGSGIDVDTKITDTLQIVSLQLNKMKSRKS
CGLAIGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Molecule Role Protective antigen
Molecule Role Annotation Female BALB/c mice were immunized with chlamydial major outer membrane protein (MOMP) mixed with cholera toxin and CpG oligodeoxynucleotide adjuvants by either the IN or TCI routes. Both intranasal and transcutaneous immunization protected mice against respiratory challenge with Chlamydia (Skelding et al., 2006).
Related Vaccines(s) C. muridarum MOMP protein vaccine
References