VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

LcrV from y. pestis CO92

Gene Name LcrV from y. pestis CO92
Sequence Strain (Species/Organism) Yersinia pestis CO92
VO ID VO_0010874
NCBI Gene ID 1172676
NCBI Protein GI 16082719
Locus Tag YPCD1.31c
Genbank Accession AL117189
Protein Accession NP_395165
3D structure: PDB ID 1R6F
Taxonomy ID 214092
Plasmid No pCD1
Gene Starting Position 21934
Gene Ending Position 22914
Gene Strand (Orientation) -
Protein Name secreted effector protein
Protein pI 5.66
Protein Weight 35651.56
Protein Length 326
Protein Note V antigen; low calcium response protein V; functions in needle complex protein export; Yop secretion and targeting control protein; important for translocation pore formation; induces IL-10 production by macrophages; interacts with Toll-like receptor 2
DNA Sequence
>NC_003131.1:21934-22914 Yersinia pestis CO92 plasmid pCD1, complete sequence
GTCATTTACCAGACGTGTCATCTAGCAGACGTTGCATCACTGAATCATATTTCTGAATGAAACGGTTCAG
TGCTTCAATAGCTGAATTAAAACGTGATGTAATATCAGACAGCTGAGTTGTTTTTTGGCTAACCAAGTCG
TTGAGCGGCCTGGACTTATCCGAGCAGGTGGTGGCAAAGTGAGATAATTCATTATTATCTTTATTATAAG
AGTATGAGTTTTTCAGATTACCCAACGCCCCGGTTCTTTTATTCTCACTTCCAAGAAAGTCCTTTATCGA
GACTATTTTTTTCTCGCTCCCATCCACCTGAATGGTGGTTTGAGGCATTTTCTCGAGAATTTTGTACTCT
GCGCTGGCTTTAAAAATCTCTTCATCTGTATAACCATATAAATTTTTATCCATGAGATTAATGGATTTAT
CATGGATATTTATGGTGCCACTACTAGACAGATGCTTATTAATTTCGGCTTGAATAACTGAATAAATCTT
TAATTCGGCGGTAAGCTCAGCTAATTCTTCACGCAACTTGCTACGGGCATCACCATGATGATTCATTGAA
TCAACAATCACTTTCAAAATATCATCATCGATACGATCGGCGGTTAAAGAGAAATGCATTACTGCCATGA
ACGCCCGCAATTCCCATTGTGTATTCGGCGATGATTCAAGGAACTCTTTTACTCGCTTGATGCCATTTTG
CAGTTGGTTGTCATAATGACCGCCTTTAAGAATGGCATCCTCGGGTAGAAAATAAGCTAGGATTTTCTTG
AGCAATTCGATATCATCAGTAATTACTCTATTGGCAAAAACCTCCGAATCTTTTCTGGGATCATATTTAA
TGGAAATATCTATATTTTTATCTTTGACTAACTGAACCAATTCTTCTAAAACTGAAGAACCATGACCAGT
AAGTTGTTCCACCCTAACTTTTTCTAGATCCTCAATAAAATGTTGTGGGTTTTGTTCGTAGGCTCTAATC
A

Protein Sequence
>NP_395165.1 secreted effector protein (plasmid) [Yersinia pestis CO92]
MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNIDISIKYDPRKDSEVFANRVITDDIEL
LKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEFLESSPNTQWELRAFMAVMHFSLTADRIDDDILKVIV
DSMNHHGDARSKLREELAELTAELKIYSVIQAEINKHLSSSGTINIHDKSINLMDKNLYGYTDEEIFKAS
AEYKILEKMPQTTIQVDGSEKKIVSIKDFLGSENKRTGALGNLKNSYSYNKDNNELSHFATTCSDKSRPL
NDLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK

Molecule Role Protective antigen
Molecule Role Annotation MAb BA5 protected animals against plague, neutralized the Y. pestis type III secretion pathway and promoted opsonophagocytic clearance of bacteria in blood. LcrV residues 196-225 were necessary and sufficient for MAb BA5 binding. These results identify LcrV residues 196-225 as a linear epitope that is recognized by the murine immune system to confer plague protection (Quenee et al., 2010).
Related Vaccines(s) Recombinant Y. pestis V antigen vaccine
References