VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

CWP2

Gene Name CWP2
Sequence Strain (Species/Organism) Giardia lamblia ATCC 50803
VO ID VO_0011080
NCBI Gene ID 5703171
NCBI Protein GI 159120052
Locus Tag GL50803_5435
Genbank Accession AACB02000001
Protein Accession XP_001710242
Taxonomy ID 50803
Gene Starting Position 1061836
Gene Ending Position 1062924
Gene Strand (Orientation) -
Protein pI 8.13
Protein Weight 37700.21
Protein Length 362
DNA Sequence
>NW_002477099.1:1061836-1062924 Giardia lamblia ATCC 50803 SC_592, whole genome shotgun sequence
TTCACCTTCTGCGGACAATAGGCTTGTTCGTGCTGCGAGGCAGAGCTCTCACGGGTGCACGCTTCGATTG
GGTCGGCTTGGTGATCGCACGAGCGGTGGGGCGGGCTACAGCAGAGCGGCTAGCATTGCCAGTCACAGAG
CTCCTCGATTGGACCGTCTTCTTGGGAGCCGTCCTGGAGCGGGACGTTGAGGCCGTCTTGCTAGATGACC
TAACCACTGTCCTGAGCGGTGTTTGGCTGCGGCTGTTTGGCATGTTGCATTTCCTCTGCGCATTGTGTGC
ACTGTTGTGCATGTTGCTCTTGGCCTTGCCACAGTTGGAGGCGCTACGAGCGTTGCAGCTTGTCTTTCGT
CCCGACGCATTGCGGACTACTGTCTGCCTGTAGTACGTGCATCCATCTCTCTCGAGAGTTGTGGGGCAGT
TTGTCGGCGGGAGAGCAGTGCAGTAATCGCAGTCTGTTGTTCCACAGAGGTAGATTCCGGTGTAGGTGTC
AGGCGCAGCTGTGCAAACGAGATCGGTGTTGCACTGGACATGAATCTCCATCATGTAAGGCAGGTCGAAG
AGATCTGCCGGAACGTCGCCAGTCAGCTCGTTGCAGTCAAGGTGGAGCTCCTTGAGGAATTGGAGTTCGT
TGACGCAGGTGGGGATGGGACCAGTGAGAGCATTAATACTCATGTACCAAAACATCATGTGGGTTAAATC
ACAGATGCACTCGGGAATGTCACCCGTCAGCCCAGCGTTGTTAATTTGCAGGTACTGCATTGAGGTGAGG
GCACAAAGATCCGTCGGGATCGGGCCCGCAAGGTCATTATTATTAAGGTACAGCGACCTCAAAAGTGGGA
AGCAGCCTATGTCGGCAGGGAGGGCACCAGTGAGCCCCATGTCAGAGAGGTCGATCCCAATAACGTTATT
GTTAGAGTCGCATGTGATGCCGGTCCAGCTACAGTAAGACACGTCGGGCGTAAGCCAGTTATTCGACTTC
CAATTAGCACCATCCAGGGCATCGTACAAATTGGTCAGGGCCTCCTCCTCGGTGGCAGGGCAAGCGGCGC
GAGCAAGACCAAGAAGTCCTAGAACAAGGGCTGCGATCA

Protein Sequence
>XP_001710242.1 Cyst wall protein 2 [Giardia lamblia ATCC 50803]
MIAALVLGLLGLARAACPATEEEALTNLYDALDGANWKSNNWLTPDVSYCSWTGITCDSNNNVIGIDLSD
MGLTGALPADIGCFPLLRSLYLNNNDLAGPIPTDLCALTSMQYLQINNAGLTGDIPECICDLTHMMFWYM
SINALTGPIPTCVNELQFLKELHLDCNELTGDVPADLFDLPYMMEIHVQCNTDLVCTAAPDTYTGIYLCG
TTDCDYCTALPPTNCPTTLERDGCTYYRQTVVRNASGRKTSCNARSASNCGKAKSNMHNSAHNAQRKCNM
PNSRSQTPLRTVVRSSSKTASTSRSRTAPKKTVQSRSSVTGNASRSAVARPTARAITKPTQSKRAPVRAL
PRSTNKPIVRRR

Molecule Role Protective antigen
Molecule Role Annotation The gene encoding the full length cyst wall protein-2 (CWP2) from Giardia lamblia was subcloned into the pCDNA3 mammalian expression vector and stably introduced into S. typhimurium STM1. Challenge infection with live Giardia muris cysts revealed that mice receiving the CWP2-encoding DNA vaccine were able to reduce cyst shedding by approximately 60% compared to control mice (Abdul-Wahid and Faubert, 2007).
Related Vaccines(s) G. duodenalis DNA vaccine encoding CWP2
References