VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Gc

Gene Name Gc
Sequence Strain (Species/Organism) Seoul virus
VO ID VO_0011085
NCBI Protein GI 284157806
Other Database IDs CDD:144961
Taxonomy ID 1980490
Gene Strand (Orientation) ?
Protein Name Gc glycoprotein
Protein pI 6.5
Protein Weight 11999.31
Protein Length 170
Protein Note Hantavirus glycoprotein G2; pfam01561
Protein Sequence
>ADB80030.1 Gc glycoprotein, partial [Seoul orthohantavirus]
VPLWTDNAHGVGSVPMHTDLELDFSLPSSSKYTYKRHLTNPVNDQQSVSLHIEIESQGIGADVHHLGHWY
DARLNLKTSFHCYGACTKYQYPWHTAKCHFEKDYEY

Molecule Role Protective antigen
Molecule Role Annotation Seoul virus (SEOV) is one of the four known hantaviruses causing hemorrhagic fever with renal syndrome (HFRS). A replication-competent recombinant canine adenovirus type 2 expressing the Gc protein of SEOV (rCAV-2-Gc) in BALB/c mice induced complete protection against a intensive infectious challenge with ~1,000 50% infective doses (ID50) for SEOV strain CC-2 (Yuan et al., 2010).
Related Vaccines(s) Seoul virus vaccine rCAV-2-Gc
References