VIOLIN: Vaccine Investigation and Online Information Network

SH
Gene Name	SH
NCBI Protein GI	ASU47779
Locus Tag	ASU47779
Protein Accession	ASU47779
Other Database IDs	CDD:281565
Taxonomy ID	208895
Gene Strand (Orientation)	?
Protein Name	small hydrophobic protein
Protein pI	8.51
Protein Weight	7860.84
Protein Length	64
Protein Note	J163; genotype: BA9
Protein Annotation	(Gan et al., 2012) SH protein has a single α-helical transmembrane domain and forms homopentamers in several detergents
Protein Sequence	>ASU47779.1 small hydrophobic protein [Human respiratory syncytial virus B] MGNTSITIEFTSKFWPYFTLIHMILTLISLLIIITIMIAILNKLSEHKTFCNKTLEQGQMYQINT
Molecule Role	Protective antigen
Molecule Role Annotation	(Gan et al., 2012) Without the SH protein, it leads to viral attenuation and it prevents apoptosis in infected cells.
References