VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

YopD from Y. pestis CO92

Gene Name YopD from Y. pestis CO92
Sequence Strain (Species/Organism) Yersinia pestis CO92
VO ID VO_0010878
NCBI Gene ID 1172673
NCBI Protein GI 16082716
Locus Tag YPCD1.28c
Genbank Accession AL117189
Protein Accession NP_395162
Taxonomy ID 214092
Plasmid No pCD1
Gene Starting Position 19293
Gene Ending Position 20213
Gene Strand (Orientation) -
Protein Name secreted effector protein
Protein pI 6.98
Protein Weight 31501.57
Protein Length 306
Protein Note Yop targeting negative regulator; translocon component; important for translocation pore formation
DNA Sequence
>NC_003131.1:19293-20213 Yersinia pestis CO92 plasmid pCD1, complete sequence
GTCAGACAACACCAAAAGCGGCTTTCATGGCGTGAGTATGACTGCTAACATATTGTTCAATCAAGCGCAG
GACATCTTTCATAAAGTTATCATTATAGTTCATCGCCTCTTCGGCTTTTTGCTTCTCGTTGGCAGCAATA
CTTGCATTGACTTCTTTCTCTTTGACCTCGGCTTGAGAATACCCTTGATGAACTTGAATCGCACTGTTTG
CCATTTGTCCTAACGGCTGCGTTGCGGCATTAAACGCATTGGCTTTTGAGTCGGTCATTCTGAATTCTTT
ATCCAATAATGCCAGCTTATTTTGATCCGCTACCTGCTCTGGTTTCCATATTCTCCCGATATCCTCTCTG
CTTACCGCTTTATCACCAATGTTACTCATTTGCTGCATTTTTGTATCAATAAGTTGTTCGCGGCCAGCAA
TATTACTGTTTAGAATTTGTTCCTGTTTAACTATTTTCACCTCTTTCGCTATAGAAAAAGCACTAGCAAC
CGTAGAAGTAGCAGCCATGATGCCAGACACCACCGCCATGGCGATCATCAGTTTTGCACCGCTGACCATC
TCCGCTACCTGCTCCTTTTGGGCAGTAATAGTAGCTTTATTTTCTATATCCCTTTGTTGCAAACCCATTT
CTCGCGCTTTACGTGCCAGTTCCAACAGCAACAACAAGATACTTAAAGTACCATTAAGATCACCCTGGCT
TTTACTCAGTAATGCAACATTGATTCCCTGGCTCGGTTTGATCAATTCTGGCACCTGTGACCGAGATAAG
CTTGCCTCGCTACTCTTTATTGCTTGTGCTTCATGACGGGTGTCTTCTGTTTTTTTAATCTCACCGCTTT
GCTTGACTGTCTCTGTAGTGATGGCATCAAGCTGTGAACCGGTCGTGATAATTGGGCTGTCTGTCTTGAT
ATTTATTGTCA

Protein Sequence
>NP_395162.1 secreted effector protein (plasmid) [Yersinia pestis CO92]
MTINIKTDSPIITTGSQLDAITTETVKQSGEIKKTEDTRHEAQAIKSSEASLSRSQVPELIKPSQGINVA
LLSKSQGDLNGTLSILLLLLELARKAREMGLQQRDIENKATITAQKEQVAEMVSGAKLMIAMAVVSGIMA
ATSTVASAFSIAKEVKIVKQEQILNSNIAGREQLIDTKMQQMSNIGDKAVSREDIGRIWKPEQVADQNKL
ALLDKEFRMTDSKANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNYNDNF
MKDVLRLIEQYVSSHTHAMKAAFGVV

Molecule Role Protective antigen
Molecule Role Annotation The type III secretion apparatus encoded on the low-calcium response (LCR) virulence plasmid, pCD1 in strain KIM5, of Y. pestis is a conserved virulence mechanism that is absolutely required for virulence of Y. pestis. YscF is a surface localized protein required both to secrete Yops and to translocate toxins into eukaryotic cells. YscF polymerization is possibly required for a YscF needle to puncture eukaryotic cell membranes. It is also likely that YscF and its homologs function to provide a base that a translocon complex is built upon, or that YscF builds a conduit from the bacterium to the eukaryotic membrane - this suggestion seems more likely given that other proteins such as YopB, YopD, and LcrV are also required for translocation into eukaryotic cells. YscF is thought to be a surface-expressed protein in Y. pestis and is required for virulence. YscF has been found to function as a protective antigen against experimental plague infection (Matson et al., 2005).
Related Vaccines(s) Recombinant Y. pestis YopD protein vaccine
References