VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PUUVsSgp1

Gene Name PUUVsSgp1
Sequence Strain (Species/Organism) Puumala orthohantavirus
VO ID VO_0011088
NCBI Gene ID 2943083
NCBI Protein GI 38371721
Locus Tag PUUVsSgp1
Genbank Accession HE801633
Protein Accession NP_941984
Taxonomy ID 1980486
Gene Starting Position 42
Gene Ending Position 1343
Gene Strand (Orientation) +
Protein Name nucleocapsid protein
Protein pI 6.05
Protein Weight 46970.43
Protein Length 433
DNA Sequence
>NC_005224.1:42-1343 Puumala virus segment S, complete sequence
AATGAGTGACTTGACAGATATCCAAGAGGATATAACCCGCCATGAACAGCAACTTATTGTTGCCAGACAA
AAACTTAAGGATGCAGAGAGAGCAGTGGAAGTGGACCCAGATGACGTTAATAAAAACACACTGCAAGCCA
GGCAACAAACAGTGTCAGCACTGGAGGACAAACTCGCAGACTACAAGAGAAGGATGGCAGATGCTGTGTC
CAGGAAAAAAATGGATACTAAACCTACTGACCCGACTGGGATTGAACCTGATGACCACCTCAAGGAGAGA
TCAAGCCTTAGGTATGGAAATGTCCTTGATGTAAATGCAATTGACATTGAAGAACCAAGTGGCCAAACAG
CAGATTGGTATACAATTGGAGTGTATGTGATAGGGTTCACACTTCCTATCATCCTTAAAGCTTTATACAT
GCTCTCAACGCGTGGGAGACAGACTGTAAAGGAAAATAAGGGGACACGTATAAGGTTTAAGGATGATACA
TCATTTGAAGACATCAATGGCATAAGGAGACCAAAGCATTTATATGTTTCTATGCCTACTGCCCAGTCAA
CTATGAAAGCAGAAGAACTCACACCTGGCAGATTTCGCACAATAGTATGTGGTCTTTTTCCCACTCAGAT
CCAGGTTCGTAACATCATGAGTCCAGTTATGGGGGTCATTGGTTTTTCATTCTTTGTGAAGGATTGGTCT
GAGAGAATCAGAGAGTTCATGGAAAAAGAGTGCCCATTCATAAAGCCTGAAGTAAAACCAGGCACACCAG
CACAGGAGATTGAGATGTTAAAAAGAAATAAGATCTACTTTATGCAGCGCCAGGATGTGCTTGACAAAAA
TCATGTGGCAGACATTGACAAGTTAATTGACTATGCAGCCTCTGGAGACCCTACATCACCTGACAACATT
GATTCGCCTAATGCACCATGGGTCTTTGCATGTGCACCAGACCGATGCCCACCAACATGTATCTATGTTG
CAGGGATGGCAGAGCTTGGGGCCTTTTTTTCAATATTGCAGGACATGAGAAACACAATAATGGCATCTAA
GACTGTTGGCACAGCAGAAGAGAAATTAAAGAAAAAGTCTTCCTTTTACCAATCTTACCTGCGTCGAACT
CAATCAATGGGAATTCAGCTTGATCAAAGAATTATCCTCTTGTTTATGTTGGAATGGGGCAAAGAGATGG
TAGATCACTTCCATCTTGGTGATGATATGGATCCAGAGCTCAGAGGTCTTGCACAGGCACTGATAGATCA
AAAGGTCAAGGAAATATCGAACCAGGAACCACTAAAGATATA

Protein Sequence
>NP_941984.1 nucleocapsid protein [Puumala orthohantavirus]
MSDLTDIQEDITRHEQQLIVARQKLKDAERAVEVDPDDVNKNTLQARQQTVSALEDKLADYKRRMADAVS
RKKMDTKPTDPTGIEPDDHLKERSSLRYGNVLDVNAIDIEEPSGQTADWYTIGVYVIGFTLPIILKALYM
LSTRGRQTVKENKGTRIRFKDDTSFEDINGIRRPKHLYVSMPTAQSTMKAEELTPGRFRTIVCGLFPTQI
QVRNIMSPVMGVIGFSFFVKDWSERIREFMEKECPFIKPEVKPGTPAQEIEMLKRNKIYFMQRQDVLDKN
HVADIDKLIDYAASGDPTSPDNIDSPNAPWVFACAPDRCPPTCIYVAGMAELGAFFSILQDMRNTIMASK
TVGTAEEKLKKKSSFYQSYLRRTQSMGIQLDQRIILLFMLEWGKEMVDHFHLGDDMDPELRGLAQALIDQ
KVKEISNQEPLKI

Molecule Role Protective antigen
Molecule Role Annotation To investigate the ability of recombinant N (rN, nucleocapsid proteins) from different hantaviruses to elicit cross-protection, we immunized bank voles with rN from Puumala (PUUV), Topografov (TOPV), Andes (ANDV), and Dobrava (DOBV) viruses and subsequently challenged them with PUUV. All animals immunized with PUUV (PUUVsSgp1) and TOPV rN were completely protected (de et al., 2002).
Related Vaccines(s) Puumala virus PUUVsSgp1 (NP) protein vaccine
References