>AAB02907.1 M polyprotein, partial [Hantaan orthohantavirus]
TPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSVDLHIEIEEQTIGVDVHALG
HWFDGRLNLKTSFHCYGACTKYDYPWHTAKCHYERDYQ
Molecule Role
Protective antigen
Molecule Role Annotation
Researchers vaccinated hamsters with a vaccinia virus-vectored vaccine expressing the M and the S segments of Hantaan (HTN) virus and challenged them with HTN, Seoul (SEO), or Puumala (PUU) virus. Study found that vaccinated hamsters, challenged with HTN or SEO virus, were neither viremic nor had evidence of virus in their lungs or kidneys (Chu et al., 1995).
