>BAF48754.1 hepatitis B surface antigen, partial [Hepatitis B virus]
NFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPL
IPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFS
Molecule Role
Protective antigen
Molecule Role Annotation
Study compared a current HBV vaccine that contains recombinant hepatitis B surface antigen HBsAg) adsorbed to alum in chimpanzees, with two novel vaccine strategies that have proven superior to the current vaccine in mice. All animals receiving either control or CpG-containing subunit vaccines at 0 and 4 weeks attained titers of HBsAg-specific antibody (anti-HBs) considered protective (> or =10 mIU/ml) and were indeed protected from challenge at 8 weeks with 10(3.5) 50% chimp infectious doses (CID(50)) of intravenous HBV (Payette et al., 2006).
