VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Lef from B. anthracis str. A2012

Gene Name Lef from B. anthracis str. A2012
Sequence Strain (Species/Organism) Bacillus anthracis str. A2012
VO ID VO_0010857
NCBI Gene ID 1158731
NCBI Protein GI 21392848
Locus Tag BXA0172
Genbank Accession AE011190
Protein Accession NP_652928
3D structure: PDB ID 1J7N
Taxonomy ID 191218
Gene Starting Position 149356
Gene Ending Position 151785
Gene Strand (Orientation) -
Protein Name lethal factor
Protein pI 5.69
Protein Weight 89799.18
Protein Length 809
DNA Sequence
>NC_003980.1:149356-151785 Bacillus anthracis str. A2012 plasmid pXO1, complete sequence
CTTATGAGTTAATAATGAACTTAATCTGATCGTTAATAAATTGGAAAGTTTTCGGAGCATTTTTTTGAAC
TTTTAAACGTTCAGCATGGTCCGTAGAATGCATTAACCTAAAGGCTTCTGCAAAAAATTCCGCTTCATTT
GTTCTCCCATACGAAGTTAAATTACTCCCTTCTTCCTTAAAAATATCAATGAATTTTTTAGAATTTGTAA
CTAAATCAGATTGGTTCTTATCTAATAGATATCCAGCATAATCATCCACAGCATGTCCAAATTCGTGTAT
AAAACCCTCACTATCATTCCTTAATTCTACACCTTTTGAAGGTCCATGGAGTAATATAGAACGGGATTCT
GGAACATATAACCCTTTTGAATGAACTTGCTCATATATCTCATCTTGATGTGTATATTGTTCAGCTATAT
TAGGGAGAGTAATATCGGTAAAAACAAATCTTCCATTACCATCAACTAAGTAATTTGTTACCTTTTTTAT
AAGATCACTTTGAATATTATTTTTCCATTCATTCAATATTAAATAAGCACTTTCTACAATATTGGATGCA
TATCTATTATGCACGTTGAATGTAATAAGCTTTGTATATTTTGGTAACCCTAATGCTTTATTCCATTCCT
GATTTATATTTAACTGTGCTTCTTGAATTTTTGTATCTATTTTACTCTTTGGCACTACTTTCGCATCAAT
CCTTATATATTCTTTTTCGGATTGCTTAATTATTTGTACATCCTTTATTTCCAGACCGATGTTTCTTTGT
AATATAAGCTTTCCATTTTCTAAATATCCTGCTCGAGTATCTGGTGATAATTGGATTCTCCATTTCAAAC
GCTCATTATCTAATGCAGGCCTTTCATTTATATCAACAATCATATAGTTACTAGAAATACTATATTTGAA
ATTTTTTTTGAATTCATTGAAAATACCTCTATTAATTTTAGTATTATCAGTGGAATCAACTAAATCCGCA
CCTAGGGTTGCTGTAAGGTTATTGATATTCATATTTTCATACAAATAAATTTTATTGTACAAGGTACTTC
CAATGGATTGATGTAATAAAGCATCAATATTTTGAATATCCCTTTTATACTGCTTTCTTACATCAAGATT
AATTGACGGACTATCAATTAACCCTCCTGTATCTTGCAACCTTTGATTAATATCATATGGTTGAATATCA
AGTTTCAGCTTTTTTAAAAACTCTTTTTCTTTTTCAGATAAAGGATTACTACTATCCACCTGTATTCTAT
TTAAAAGCTCTTTTTCTTCTTCAGATAAAGAATCACGAATATCAATTTGTAGCTTTTTTAAAAACTCTTT
TTCCTCAGTAGATAAAAAATCACTACTATCAATTTGTATTCTTTTTAGAAGCTCTTTTTCTTCTTGAGAT
AAAGAATGAATTATGTCATCTTTCTTTGGCTCAATAGGAATCTGCAGCTTTTTTAAAAGTCCTCTTCCTT
CTTCAGATAAAGAATCGCTCCAGTGTTGATAGTGCTGTTTTATCTTTTCCCATTTTTCATATCTTGCCAG
CATCCGTTGATCTTTAAGTTCTTCCAAGGATAGATTTATTTCTTGTTCGTTAAATTTATCCATGTAATTA
AAAGCTTCCGGTGCATAAAGCTGTAAAACATCACGATGCTGTGGCTCGATATAATATGCAAAAGCTTTCG
CAAATACTTCTTGTACCTCATTGCTATTTTGTTCCAAGAATTCTACAGAAAAGTCTGTGGGATGTTCCTT
AAGCTGATTAGTAAATAAAAGATCTTGTCCATCTGAATCAGATGCATTTTTAATGGTATTTAATACATCT
AAAAATTTCTGATATGGTTGATTAATTTTACTTAAAATATCCCTTGATAATATCTTACCTATTTCATAAT
AAACGTTCAGTGCCTTTTCAGTATTTTCTACATAATCTTCCGAAGATTGGATTACAAGTACGGGTTCATA
TCCTTCTTTTGCATATACATAATGTTCATGTAATAAAGCATCTTTCCCATAAATGTCTTTTATTTTTTTC
TTATCTTCAGATAATGCTTCTAAAGATATATGTTTTGTAATATCACCATCCACAATATATATCTTTCCTC
CAATTGCTTTATACATCTCTAAAACATCAGATGGTACTTTCTCAAGTAGCTTTTCTGCTGCCTCTTTTTT
AACAGCTTCCTCCCCTTTTACTTCTATTTTTACAATGTGTTTCATGATTTCCTTTAAATGCTCTTCCTGT
GTTTTATTTCGTTCTTCATCTTTTCTCTTATTCTCATCTTTATTTTTCTCTTTCTCTTTTACGTGCATAC
CTACATCACCATGACCGCCCGCCCCCTGTACAAGGGGGATAAAGACGGGACCACTCAAAGTAATTGCTGT
TACTAAACATGACATACTAATTACTTTTATAAATTCTTTTTTTATATTCA

Protein Sequence
>NP_652928.1 lethal factor (plasmid) [Bacillus anthracis str. A2012]
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLK
EIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDI
YGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTI
KNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKF
NEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKE
LLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDS
TDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGL
EIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVE
SAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSIL
LHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFF
AEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS

Molecule Role Protective antigen
Related Vaccines(s) DNA vaccine encoding PA83 and LF
References