VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

HA

Gene Name HA
Sequence Strain (Species/Organism) Equine influenza virus H3N8
VO ID VO_0011112
NCBI Protein GI 404517
Other Database IDs CDD:278910
Taxonomy ID 907195
Gene Strand (Orientation) ?
Protein Name hemagglutinin
Protein pI 7.4
Protein Weight 61514.34
Protein Length 648
Protein Note HA
Protein Sequence
>AAB27733.1 hemagglutinin [Influenza A virus (A/equine/Taby/1991(H3N8))]
MKTTIILILLTHWVYSQNPTSGNNTATLCLGHHAVANGTLVKTITDDQIEVTNATELVQSISIGKICNNS
YRVLDGRNCTLIDAMLGDPHCDDFQYENWDLFIERSSAFSNCYPYDIPDHASLRSIVASSGTLEFTAEGF
TWTGVTQNGGSGACKRGSADSFFSRLNWLTKSGNSYPILNVTMPNNKNFDKLYIWGIHHPSSNKEQTKLY
IQESGRVTVSTERSQQTVIPNIGSRPWVRGQSGRISIYWTIVKPGDILMINSNGNLVAPRGYFKLRTGES
SVMRSDALIGTCVSECITPNGSIPNDKPFQNVNKVTYGKCPKYIRQNTLKLATGMRNVPEKQIRGIFGAI
AGFIENGWEGMVDGWYGFRYQNSEGTGQAADLKSTQAAIDQINGKLNRVIERTNEKFHQIEKEFSEVEGR
IQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDAEMNKLFEKTRRQLRENAEDMGGGCFKIYHKCDN
ACIGSIRNGTYDHYIYRDEALNNRFQIKGVELKSGYKDWILWISFAISCLLICVVLLGFIMWACQKGNIR
CNICI

Molecule Role Protective antigen
Molecule Role Annotation Skin and mucosal vaccination provided complete protection from clinical signs of infection with ponies subjected to a challenge infection of Equine influenza virus, while skin vaccination provided partial protection; DNA vaccination provided partial protection from viral shedding (Lunn et al., 1999).
Related Vaccines(s) Influenza virus DNA vaccine encoding HA of Equine influenza virus H3N8
References