VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

NS1 from Influenza virus

Gene Name NS1 from Influenza virus
Sequence Strain (Species/Organism) Influenza virus
NCBI Protein GI 505039
3D structure: PDB ID 3EE8
Other Database IDs CDD:144260
GOA:Q82804
HSSP: P03495
InterPro: IPR000256
InterPro: IPR009068
UniProtKB/TrEMBL: Q82804
Taxonomy ID 380299
Gene Strand (Orientation) ?
Protein Length 230
Protein Note Influenza non-structural protein (NS1); pfam00600
Protein Sequence
>gi|505039|emb|CAA47139.1| NS1 [Influenza A virus (A/turkey/Wisconsin/1968(H5N9))]
MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATMEGKKMVEDILK
SETDENLKIAIASSPAPRYITDMRIEKISRDWYMLMPRQKITGGLMVKVDQAIMDKRIILKANFSVLFDQ
LETLVSLRAFTDDGAMVAEISPIPSMPGHSTEDVKNAIGILIGELEWNDNSIRASENIQRFAWGIRDEDG
GPPLPPKQKRYMARRVESEV
Molecule Role Virmugen
Molecule Role Annotation Intranasal inoculation of mice, pigs, horses, and macaques with NS1-modified influenza virus strains induced robust humoral and cellular immune responses, and generated immune protection against challenge with wild-type virus (Richt and García-Sastre, 2009).
Related Vaccines(s) Influenza virus NS1 mutant vaccine
References