VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ha

Gene Name ha
Sequence Strain (Species/Organism) Influenza A virus (A/chicken/Italy/13474/99(H7N1))
VO ID VO_0011116
NCBI Protein GI 32261025
Other Database IDs CDD:278910
GOA:Q7TDW9
HSSP: 1IBN
InterPro: IPR000149
InterPro: IPR001364
InterPro: IPR008980
InterPro: IPR013827
InterPro: IPR013828
InterPro: IPR013829
UniProtKB/TrEMBL: Q7TDW9
Taxonomy ID 199442
Gene Strand (Orientation) ?
Protein Name hemagglutinin
Protein pI 6.57
Protein Weight 60465.11
Protein Length 653
Protein Note Haemagglutinin; pfam00509
Protein Sequence
>CAD37074.1 hemagglutinin [Influenza A virus (A/chicken/Italy/13474/99(H7N1))]
MNTQILVFALVAIIPTNADKICLGHHAVSNGTKVNTLTERGVEVVNATETVERTNVPRICSKGKRTVDLG
QCGLLGTITGPPQCDQFLEFSADLIIERREGSDVCYPGKFVNEEALRQILRESGGIDKEAMGFTYSGIRT
NGTTSTCRRSGSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRKDPALIIWGIHHSGSTTEQTKLYGSGNKL
ITVGSSNYQQSFVPSPGERPQVNGQSGRIDFHWLMLNPNDTVTFSFNGAFIAPDRASFLRGKSMGIQSGV
QVDANCEGDCYHSGGTIISNLPFQNINSRAVGKCPRYVKQESLLLATGMKNVPEIPKGSRVRRGLFGAIA
GFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQVTGKLNRLIEKTNQQFELIDNEFTEVEKQI
GNVINWTRDSMTEVWSYNAELLVAMENQHTIDLTDSEMNKLYERVKRLLRENAEEDGTGCFEIFHKCDDD
CMASIRNNTYDHSKYREEAMQNRIQIDPVKLSSGYKDVILWFSFGASCFILLAIAMGLVFICVRNGNMRC
TICI

Molecule Role Protective antigen
Molecule Role Annotation Mice and ferrets were immunised with two doses of the split virus vaccine (12-24 microg haemagglutinin derived from Influenza A virus (A/chicken/Italy/13474/99(H7N1))) with or without aluminium hydroxide adjuvant and challenged 3 weeks after second dose with the highly pathogenic A/chicken/Italy/13474/99 (H7N1) virus. The vaccine induced significant protection from disease after challenge with the wild-type virus. In the murine lethal challenge model, vaccination effectively prevented death and, furthermore, formulation with adjuvant reduced excessive weight loss and viral shedding (Cox et al., 2009).
Related Vaccines(s) Avian influenza virus DNA vaccine pCMV-HA
References