VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

YscF from Y. pestis CO92

Gene Name YscF from Y. pestis CO92
Sequence Strain (Species/Organism) Yersinia pestis CO92
VO ID VO_0010913
NCBI Gene ID 1172700
NCBI Protein GI 16082743
Locus Tag YPCD1.55
Genbank Accession AL117189
Protein Accession NP_395189
Taxonomy ID 214092
Plasmid No pCD1
Gene Starting Position 41025
Gene Ending Position 41288
Gene Strand (Orientation) +
Protein Name needle complex major subunit
Protein pI 7.54
Protein Weight 9092.63
Protein Length 87
Protein Note type III secretion apparatus component
DNA Sequence
>NC_003131.1:41025-41288 Yersinia pestis CO92 plasmid pCD1, complete sequence
AATGAGTAACTTCTCTGGATTTACGAAAGGAACCGATATCGCAGACTTAGATGCGGTGGCTCAAACGCTC
AAGAAGCCAGCAGACGATGCAAACAAAGCGGTTAATGACTCGATAGCAGCATTGAAAGATAAGCCTGACA
ACCCGGCGCTACTTGCTGACTTACAACATTCAATTAATAAATGGTCGGTAATTTACAATATAAACTCAAC
CATAGTTCGTAGCATGAAAGACTTAATGCAAGGCATCCTACAGAAGTTCCCATA

Protein Sequence
>NP_395189.1 needle complex major subunit (plasmid) [Yersinia pestis CO92]
MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDKPDNPALLADLQHSINKWSVIYNINST
IVRSMKDLMQGILQKFP

Molecule Role Protective antigen
Molecule Role Annotation Ten mice were inoculated subcutaneously, administered booster injections after one month, and challenged with 130 LD(50) of wild type Y. pestis CO92. The vaccinated animals produced high levels of specific antibodies against YscF as determined by Western blot. The data were statistically significant (P = 0.053 by two-tailed Fisher's test), suggesting that the YscF protein can provide a protective immune response against lethal plague challenge during subcutaneous plague infection (Swietnicki et al., 2005).
Related Vaccines(s) Y. pestis YscF Protein Vaccine , Y. pestis YscF subunit vaccine
References