VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Apa

Gene Name Apa
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0011175
NCBI Gene ID 885896
NCBI Protein GI 57116926
Locus Tag Rv1860
Genbank Accession AL123456
Protein Accession YP_177849
Taxonomy ID 83332
Gene Starting Position 2107735
Gene Ending Position 2108712
Gene Strand (Orientation) +
Protein Name hypothetical protein
Protein pI 4.7
Protein Weight 30636.65
Protein Length 325
Protein Note Rv1860, (MT1908, MTCY359.0013), len: 325 aa. apa (alternate gene names: mpt32, modD), Ala-, Pro-rich 45/47 kDa secreted protein, very similar to P46842|N43L_MYCLE from Mycobacterium leprae (287 aa), FASTA scores: opt: 1166, E(): 0, (66.4% identity in 298 aa overlap). Known to be glycosylated fibronectin-binding protein (see some citations). CHANGES IN THE MANNOSYLATION PATTERN OF THIS PROTEIN AFFECT ITS ABILITY TO STIMULATE T-LYMPHOCYTE RESPONSE. MAJOR IMMUNODOMINANT ANTIGEN THAT HAS POTENTIAL AS A VACCINE AGAINST TUBERCULOSIS. APA-ELISA COULD BE USED IN DIAGNOSIS. TBparse score is 0.924.; mpt32; modD
DNA Sequence
>NC_000962.3:2107735-2108712 Mycobacterium tuberculosis H37Rv, complete genome
CATGCATCAGGTGGACCCCAACTTGACACGTCGCAAGGGACGATTGGCGGCACTGGCTATCGCGGCGATG
GCCAGCGCCAGCCTGGTGACCGTTGCGGTGCCCGCGACCGCCAACGCCGATCCGGAGCCAGCGCCCCCGG
TACCCACAACGGCCGCCTCGCCGCCGTCGACCGCTGCAGCGCCACCCGCACCGGCGACACCTGTTGCCCC
CCCACCACCGGCCGCCGCCAACACGCCGAATGCCCAGCCGGGCGATCCCAACGCAGCACCTCCGCCGGCC
GACCCGAACGCACCGCCGCCACCTGTCATTGCCCCAAACGCACCCCAACCTGTCCGGATCGACAACCCGG
TTGGAGGATTCAGCTTCGCGCTGCCTGCTGGCTGGGTGGAGTCTGACGCCGCCCACTTCGACTACGGTTC
AGCACTCCTCAGCAAAACCACCGGGGACCCGCCATTTCCCGGACAGCCGCCGCCGGTGGCCAATGACACC
CGTATCGTGCTCGGCCGGCTAGACCAAAAGCTTTACGCCAGCGCCGAAGCCACCGACTCCAAGGCCGCGG
CCCGGTTGGGCTCGGACATGGGTGAGTTCTATATGCCCTACCCGGGCACCCGGATCAACCAGGAAACCGT
CTCGCTCGACGCCAACGGGGTGTCTGGAAGCGCGTCGTATTACGAAGTCAAGTTCAGCGATCCGAGTAAG
CCGAACGGCCAGATCTGGACGGGCGTAATCGGCTCGCCCGCGGCGAACGCACCGGACGCCGGGCCCCCTC
AGCGCTGGTTTGTGGTATGGCTCGGGACCGCCAACAACCCGGTGGACAAGGGCGCGGCCAAGGCGCTGGC
CGAATCGATCCGGCCTTTGGTCGCCCCGCCGCCGGCGCCGGCACCGGCTCCTGCAGAGCCCGCTCCGGCG
CCGGCGCCGGCCGGGGAAGTCGCTCCTACCCCGACGACACCGACACCGCAGCGGACCTTACCGGCCTG

Protein Sequence
>YP_177849.1 hypothetical protein Rv1860 [Mycobacterium tuberculosis H37Rv]
MHQVDPNLTRRKGRLAALAIAAMASASLVTVAVPATANADPEPAPPVPTTAASPPSTAAAPPAPATPVAP
PPPAAANTPNAQPGDPNAAPPPADPNAPPPPVIAPNAPQPVRIDNPVGGFSFALPAGWVESDAAHFDYGS
ALLSKTTGDPPFPGQPPPVANDTRIVLGRLDQKLYASAEATDSKAAARLGSDMGEFYMPYPGTRINQETV
SLDANGVSGSASYYEVKFSDPSKPNGQIWTGVIGSPAANAPDAGPPQRWFVVWLGTANNPVDKGAAKALA
ESIRPLVAPPPAPAPAPAEPAPAPAPAGEVAPTPTTPTPQRTLPA

Molecule Role Protective antigen
Molecule Role Annotation We show that the 50- to 55-kDa Apa protein, specified by the Rv1860 gene of M. tuberculosis, can elicit both lymphoproliferative response and gamma interferon (IFN-gamma) production. A poxvirus recombinant expressing the Apa protein conferred a significant level of protective immunity in guinea pigs against a challenge dose of virulent M. tuberculosis (Kumar et al., 2003).
Related Vaccines(s) M. tuberculosis DNA Vaccine APADNA priming and APAMVA boosting
References