VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lpdA

Gene Name lpdA
Sequence Strain (Species/Organism) Neisseria meningitidis
VO ID VO_0011181
NCBI Protein GI 1017430
Other Database IDs CDD:133458
CDD:304358
CDD:180579
CDD:278498
CDD:280934
GOA:Q51191
HSSP: 1OJT
InterPro: IPR000089
InterPro: IPR000815
InterPro: IPR001327
InterPro: IPR003016
InterPro: IPR004099
InterPro: IPR006258
InterPro: IPR011053
InterPro: IPR012999
InterPro: IPR013027
InterPro: IPR016156
UniProtKB/TrEMBL: Q51191
Taxonomy ID 487
Gene Strand (Orientation) ?
Protein Name outer membrane protein P64k or PM-6
Protein pI 4.94
Protein Weight 56755.94
Protein Length 685
Protein Note Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; cd06849
Protein Sequence
>CAA57206.1 outer membrane protein P64k or PM-6, partial [Neisseria meningitidis]
MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDIPAEVAGVVKEVKVKVGDKISEG
GLIVVVEAEGAATAPKAEAPATPAQEAPKAAAPAPQAAQFGGSADAEYDVVLGGGPGGYSAAFAAADEGL
KVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKNGVVSRLTGG
LAGMAKRRKVDVIQGDGQFLDPHHLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDP
RIIDSSGALALKEVPGKLLIIGAGIIGLEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVKVWQKQNEYRF
DNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGKLISAEKAGVAVTDRGFIEVDK
QMRTNVPHIYAIVDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVAWVGETELSAKA
SGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADIG
KTIHPHPTLGESIGMAAEVALGTCTDLPPQKKK

Molecule Role Other
Molecule Role Annotation Sera of the challenge group immunized with CCPS-P64kR showed a three-fold higher bactericidal response than the sera of the group immunized with the plain CCPS and they were able to protect against challenge with Neisseria meningococci in the infant rat protection model (Carmenate et al., 2004).
Related Vaccines(s) CCPS-P64kR
References