VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

lctP

Gene Name lctP
Sequence Strain (Species/Organism) Neisseria meningitidis
VO ID VO_0011185
NCBI Protein GI 254667969
Other Database IDs CDD:224535
EnsemblGenomes-Gn:NMO_0425
EnsemblGenomes-Tr:CBA04244
GOA:C6S5G4
InterPro: IPR003804
UniProtKB/TrEMBL: C6S5G4
Taxonomy ID 662598
Gene Strand (Orientation) ?
Protein Name L-lactate permease
Protein pI 8.92
Protein Weight 52305.14
Protein Length 601
Protein Note L-lactate permease [Energy production and conversion]; COG1620
Protein Sequence
>CBA04244.1 L-lactate permease [Neisseria meningitidis alpha14]
MALFLSIFPIVLLIWLMVKKNSMPSYVALPITAVLIYAIKLFYFGDAGMLLNATAASGLVKTLTPITVIF
GAIMFNRMMETTGCIDVIRKWLATISPNPVAQLMIIGWAFAFMIEGASGFGTPAAIAAPILMSLGFNPLK
VAIFTLVMNSVPVSFGAVGTPTWFGFAPLNLSAEDILAIGRQTGVMHFFAGFVIPVIGLGFIVPWSEIRK
NLGFVAIAVFSCTIPYVALAMVNEEFPSLVAGAIGLMVSVFAANQGWGLSKDHAKDPNAEKVPFAQVAKA
LAPLGMLIGMLVVTRIKQLGIKGILTSKEEWFSFQLPFDLSKITVSDSLTITFGNIFGQDVSASYQTLYV
PAWIPFVLTVWICILLYKTKFKDAWTIYSVTFNQTKKPLLALMGALIMVQLMLVGGDNSMVKIIGKEFAA
MAGEHWVYFSPYLGAIGAFFSGSNTVSNLTFGPIQQQIALDTGLSVTLILALQSVGGAMGNMVCLNNIIA
VCTVLDVKNSEGAIIKKTVIPMAIYGVIAVVAAMIFFL

Molecule Role Protective antigen
Molecule Role Annotation A total of 11 meningococcal proteins that are necessary for establishing systemic infection were expressed as recombinant antigens and assessed for their ability to protect mice against live bacterial challenge against N. meningitidis; the lactate permease (LctP) elicited protective immunity (Sun et al., 2005).
Related Vaccines(s) N. meningitidis LctP Protein Vaccine
References