VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MAG1

Gene Name MAG1
Sequence Strain (Species/Organism) Neospora caninum
VO ID VO_0011189
NCBI Protein GI 147886433
Other Database IDs CDD:274008
Taxonomy ID 29176
Gene Strand (Orientation) ?
Protein Name cyst matrix and cyst wall protein
Protein pI 5.02
Protein Weight 46643.52
Protein Length 529
Protein Note chromosome segregation protein SMC, common bacterial type; TIGR02168
Protein Sequence
>ABQ52425.1 cyst matrix and cyst wall protein [Neospora caninum]
MAFGRGKRGLHAAVILGFFVLLATSSVGLGQRVPRYPSVESLEERVAEALGRRSSAAASTLPGSDTNMIS
DGRAGRDEPTASPEHHSVDAPTTSGEGEADAGKVTLRNDEGLEGNISADHVLHPPPDSEHEGLQEPGTTH
QEAQEPDASEAMDSSALPLSTSVPHPNEVGSTPGTALPAPIFSIPELSPEEVVYVLRVQGSGDFEISFQV
GRVVRQLEAIKRAYREAHGKLEAEELESERGPTVSTRTKLVDFIKENQRRLRAAFQKVKIQQKLEEIEEL
LQLSHALKSLGARLRPCQKSNSPMEEEICRKTKALGEMVAQKAEDLRQHASTVSALLGREAVERQLRRVD
SEQPYEQTDAGVAARAEEFRKALEKAASGARQFVGTTADEIVEEVKEDAQYLRDGAKEVLTKSQRALVDA
FQAIQRALLEAKAKELVDAASKEAEDARKILAEQPA

Molecule Role Protective antigen
Molecule Role Annotation Intraperitoneal application of NcMAG1 suspended in saponin adjuvants lead to protection against disease in 50% of animals vaccinated in a C57Bl/6 mouse cerebral infection model (Debache et al., 2010).
Related Vaccines(s) N. caninum NcMAG1 Protein Vaccine
References