VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PDI

Gene Name PDI
Sequence Strain (Species/Organism) Neospora caninum
VO ID VO_0011191
NCBI Protein GI 82568727
Other Database IDs CDD:240266
CDD:294274
CDD:239259
CDD:239280
CDD:239293
Taxonomy ID 29176
Gene Strand (Orientation) ?
Protein Name protein disulfide isomerase
Protein pI 4.86
Protein Weight 49740.77
Protein Length 538
Protein Note disulphide isomerase; Provisional
Protein Sequence
>BAD67151.2 protein disulfide isomerase [Neospora caninum]
MRAGFSFVLLAVGLLATASVYCAAEEEAVTVLTASNFDDTLKNTEIVLVKFYAPWCGHCKRMAPEYEKAA
KILKEKGSKIMLAKVDATSETDIADKQGVREYPTLTLFRNQKPEKFTGGRTAEAIVEWIEKMTGPAVTEV
EGKPEEQVTKESPIAFVAELSSKDSDMAKLFEDVANESRQLGKFLAKYGVSDEKIYSLRYEEGTEPFTGK
TKDELKKFVDTESFPLLGPINAENFRKYIDRDLDLVWLCGTEKDFDEAKAAVREAAKKLRDTRSFVWLDT
DQFKGHAENALGITEFPGLVFQSKKGRFVLPEATSSLKDAAKISKFFEDVDAGKIERSLKSEPVPEKQDE
AVKVVVGKNFEEMVIQKDKDVMLEIYAPWCGYCKSFEPIYKEFAEKYKDVDHLVVAKMDGTANEAPLEEF
SWSSFPSIFFVKAGEKTPMKFEGSRTVEGLTEFINKHGSKPLKKDDKGEEL

Molecule Role Protective antigen
Molecule Role Annotation A 90% protection rate was achieved following intra-nasal vaccination with recNcPDI emulsified in cholera toxin employing the C57Bl/6 mouse cerebral infection model when challenged with Neospora caninum tachyzoites (Debache et al., 2010).
Related Vaccines(s) N. caninum NcPDI Protein Vaccine
References