VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Ply

Gene Name Ply
Sequence Strain (Species/Organism) Streptococcus pneumoniae D39
VO ID VO_0011192
NCBI Gene ID 4441611
NCBI Protein GI 116515376
Locus Tag SPD_1726
Genbank Accession CP000410
Protein Accession YP_817150
Taxonomy ID 373153
Gene Starting Position 1721456
Gene Ending Position 1722871
Gene Strand (Orientation) -
Protein Name pneumolysin
Protein pI 4.91
Protein Weight 48435.22
Protein Length 471
Protein Note equivalent gene in S.pneumoniae TIGR4 = SP1923; equivalent gene in S.pneumoniae R6 = spr1739; identified by match to protein family HMM PF01289
DNA Sequence
>NC_008533.1:1721456-1722871 Streptococcus pneumoniae D39, complete genome
CCTAGTCATTTTCTACCTTATCCTCTACCTGAGGATAGAGAGTTGTTCCCCAAATAGAAATCGTCCGCTT
ACGCACTAGTGGCAAATCGGTTTTTTCATAAACCGTACGCCACCATTCCCAGGCAAGCCCGGTACACTCT
CTAATTTTGACAGAGAGATTACGAACATTCCCTTTTAAAGGAATACTAGTGGTAAAGTGAGCCGTCAAAT
CCTGCCCATTTCTGTCCCAAGCCTTAGGAGTCAAGACTTCCTTACCTTGATGATCATAGGATAATTCATC
CCAAGTAATATAATATTGGGCAACATAGGCACCACTATGATCCAGCAGTAAATCTCCGTTTCTGTAAGCT
GTAACCTTAGTCTCAACATAGTCTGTACTGTTTTGAAAGGTCGCAACTACATTGTCACGTAAAAAAGAAG
TTGTATAGGAAATCGGCAAGCCTGGATGATCTGCTGTAAAGCGACTGCCTTCTTGAATCAAGTCCTCTAC
CATATCCACCTTGCCTGTTACAACTCGGGCACCCGAACTTGGGTCGCCCCCTAAAATAACCGCCTTCACT
TCTGTATTGTCCAAAATCTGCTTCCACTCTGTCTGAGGAGCTACCTTGACTCCTTTTATCAAAGCTTCAA
AAGCAGCCTCTACTTCATCACTCTTACTCGTGGTTTCCAACTTGAGATAGACTTGGCGCCCATAAGCAAC
ACTCGAAATATAGACCAAAGGACGCTCTGCAGAAATTCCTCTCTGTTTTAAATCCTCTACCGTTACAGTA
TCTTGAAACACATCTCCTGGATTTTTAACAGCGTCTACGCTGACTGTATAATAAATCTGCTTAAAATTAA
CAATCTGAATCTGCTTTTCACCTGAATGGACAGAGTTAAAATCAATATCAAGAGAATTCCCTGTCTTTTC
AAAGTCAGAACCAAACTTGACCTTGAGTTGTTCCATGCTGTGAGCCGTTATTTTTTCATACTGCATTCTA
GCTGGGACATTATTGACCTGACCATAATCTTGATGCCACTTAGCCAACAAATCGTTTACCGCTCCGCGAA
CACTTGAATTGCTGGGGTCTTCCACTTGGAGAAAGCTATCGCTACTTGCCAAACCAGGCAAATCAATACT
ATAAGTCATCGGAGCACGATCAACCGCAAGAAGAGTGGGATTATTCTCTAACAAGGTCTCATCCACTACG
AGAAGTGCTCCAGGATAGAGGCGACTGTCGTTGGTAGCTGTTACAGAAATATCACTTGTATTTGTCGACA
AGCTCCGCTTCTTTCTTTCGATAACAACAAACTCATCGGGTAGCTGATTACCCTCTTTGATGAAACGATT
TTCAATACTTTCTCCCTGATGGGTCAAGAGTTTCTTTTTATCGTAATTCATAGCTAGTATAAAGTCATTT
ACTGCTTTATTTGCCA

Protein Sequence
>YP_817150.1 pneumolysin [Streptococcus pneumoniae D39]
MANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRL
YPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQ
VNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNP
GDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKSDEVEAAFEALIKGVKVAPQTEWKQ
ILDNTEVKAVILGGDPSSGARVVTGKVDMVEDLIQEGSRFTADHPGLPISYTTSFLRDNVVATFQNSTDY
VETKVTAYRNGDLLLDHSGAYVAQYYITWDELSYDHQGKEVLTPKAWDRNGQDLTAHFTTSIPLKGNVRN
LSVKIRECTGLAWEWWRTVYEKTDLPLVRKRTISIWGTTLYPQVEDKVEND

Molecule Role Protective antigen
Molecule Role Annotation Immunization with the pneumococcal proteins pneumolysin (Ply), choline binding protein A (CbpA), or pneumococcal surface protein A (PspA) elicits protective responses against invasive pneumococcal disease in animal models.(Chen et al., 2015)
Additional Molecule Role Virmugen
Additional Molecule Role Annotation The protective effects a pneumolysin mutant (DeltaA146 Ply) against pneumococcal infections in mice was evaluated. Vaccinated mice were challenged with pneumococcal strain D39 at 1,500 times the LD50 (1.5 x 105 CFU) and the vaccinated mice survived significantly longer than control mice after challenge (Wu et al., 2010).
References