VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

LplA

Gene Name LplA
Sequence Strain (Species/Organism) Streptococcus pneumoniae R6
VO ID VO_0011194
NCBI Gene ID 934072
NCBI Protein GI 15903091
Locus Tag spr1047
Genbank Accession AE007317
Protein Accession NP_358641
Taxonomy ID 171101
Gene Starting Position 1041220
Gene Ending Position 1042209
Gene Strand (Orientation) -
Protein Name lipoate-protein ligase
Protein pI 5.54
Protein Weight 35144.06
Protein Length 329
Protein Note Putative
DNA Sequence
>NC_003098.1:1041220-1042209 Streptococcus pneumoniae R6 chromosome, complete genome
TTTATCCAACTACCGCTTCAGCGATTTCTTCACGGCTAATACCAGCGAAGTAGCGTGTGATATCAATGGT
TTTTAGCGCCTTAAGAACATCTTCGCGTTCGTATTTCACCCCACGAAGGACATCTTCTACTGCAGCAACG
TCTTCAATACCAAAGAAGTCACCATAAATCTTGATGTCTTGGATTTTTGATTCAGTAACGTTAGCAAAGA
CTTCAACCTTACCACTAGTGAATTTGGTTCCACGACGGACGTTAAATTCAGGTGATTTACCATAGTTCCA
GTCCCAAGTTCCAAACTTAGTATCCTTGATGCGATTGATTTCGGCCAATTCTTCTTCTGAAAAGACGTAT
TCAGTCATCTCTGGGTACTCTTTTTTCATGTATTCCAAGAGTAAATCACGGAATTTTTCGACTGTGATTT
TTTTTGGTAATTCATTGATAATATTGGTTACACGGGCACGGACGGATTTCACACCTTTTGATTCAAATTT
ATCTTTTGAAACCTTAAGGGCATTTGCGAGGACTGACAAATCAACGTCAAAGAGCAAGCAACCGTGGTGC
ATGATACGGCCGTTGATATAGGCTTGGGCATTGCCACAGAACTTCTTACCATCAATCTCAAGGTCATTAC
GACCTGTGAACTCAGCTTTAACCCCAAGTTGAGCCAGGGTATTGATAACCGGAGTTGAGAAGCTCTTGAA
GTCAAATGCCTTATTTTCATCTTCTTTGGAGATGATCGTGTAGTTGAGGTTATTTAAATCGTGGTAAACA
GCTCCACCACCACTAATACGGCGAACTACCTCAATACCATTTTCGCGAACATAATCACGGTTGATTTCTT
CGATAGTGTTCTGGTGACGACCAACAATGATAGATGGCTTGTTAATCCAAAGTAGGAAGATTTGATCCTC
ATCCAAAAGGTGTTTAAAGGCGTATTCTTCCAAGGCAATATTAAAAGCAGTGTCATTTGAATGATTGATA
ATGTATTTCA

Protein Sequence
>NP_358641.1 lipoate-protein ligase [Streptococcus pneumoniae R6]
MKYIINHSNDTAFNIALEEYAFKHLLDEDQIFLLWINKPSIIVGRHQNTIEEINRDYVRENGIEVVRRIS
GGGAVYHDLNNLNYTIISKEDENKAFDFKSFSTPVINTLAQLGVKAEFTGRNDLEIDGKKFCGNAQAYIN
GRIMHHGCLLFDVDLSVLANALKVSKDKFESKGVKSVRARVTNIINELPKKITVEKFRDLLLEYMKKEYP
EMTEYVFSEEELAEINRIKDTKFGTWDWNYGKSPEFNVRRGTKFTSGKVEVFANVTESKIQDIKIYGDFF
GIEDVAAVEDVLRGVKYEREDVLKALKTIDITRYFAGISREEIAEAVVG

Molecule Role Protective antigen
Molecule Role Annotation The production of a recombinant vaccine was achieved following PCR amplification of putative lipoate protein ligase (Lpl), with subsequent cloning and expression of the genes in E. coli. The putative lipoate protein ligase (Lpl) , resulted in a reduced CFU titre and a trend towards reduced mortality in an animal sepsis model (Morsczeck et al., 2008).
References