VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

srs2

Gene Name srs2
Sequence Strain (Species/Organism) Neospora caninum
VO ID VO_0011195
NCBI Protein GI 5579384
Other Database IDs CDD:282012
Taxonomy ID 29176
Gene Strand (Orientation) ?
Protein Name SRS2 surface antigen
Protein pI 4.55
Protein Weight 33921.17
Protein Length 403
Protein Note SRS domain; pfam04092
Protein Sequence
>AAD45524.1 SRS2 surface antigen, partial [Neospora caninum]
NEKFTCLPKQGNADQWEALVYDSQHSITFACDGGTPLPSKLLSEDDGLIVCNESDGEDECEKNAAPLSTF
LPGAKKEWVTGTLQQGIKITIPDEHYPATSKAFRVGCKAGKNVCLLNVYVQSRESEVIGQVAHCAYSSNV
RLRPITVNPENNGVTLICGPDGKAFPDDYMNHHCTELDECKERPYSAVFPGFSSSFWTGEASGVAGATLT
IPKDQFPSTAQTIYLGCTGHPDDKQATCVVPVNIEEVAKPAGAGSNPGGGSQPDQSSEKRDGEQVNKGKP
PTGGSGGATTGKQNASQNAKDKGETGGENGDSPVLRGDACDELPSYVALSAASLTA

Molecule Role Protective antigen
Molecule Role Annotation NcSAG1 and NcSRS2, the two major immunodominant tachyzoite surface antigens of the apicomplexan parasite Neospora caninum, were investigated for their potential as vaccine candidates in mice. Results suggest that a combined DNA/recombinant antigen-vaccine, based on NcSAG1 and NcSRS2, respectively, exhibited a highly significant protective effect against experimentally induced cerebral neosporosis in mice (Cannas et al., 2003).
Related Vaccines(s) N. caninum DNA vaccine encoding NcSAG1 and NcSRS2, combined with recombinant NcSAG1 and NcSRS2 Proteins , RB51--MIC3/GRA6/MIC1/SRS2 , RB51-SRS2
References