VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

psrP

Gene Name psrP
Sequence Strain (Species/Organism) Streptococcus pneumoniae ATCC 700669
VO ID VO_0011197
NCBI Gene ID 7329552
NCBI Protein GI 221232510
Locus Tag SPN23F_17820
Genbank Accession FM211187
Protein Accession YP_002511663
Taxonomy ID 561276
Gene Starting Position 1721442
Gene Ending Position 1734743
Gene Strand (Orientation) -
Protein Name cell wall surface anchored protein
Protein pI 3.83
Protein Weight 378825.55
Protein Length 4433
DNA Sequence
>NC_011900.1:1721442-1734743 Streptococcus pneumoniae ATCC 700669 complete genome
CTTACTCTTCTTCATCACGTTTACGGCGTTTCGCAACCAATCCAATACCTGTAACAGCTGCTAGAACTCC
AAGTAACACAGATCCAATTGACGACTCAGTACCTGTATTAGGCAATTCTTTTTGGGATTTACCTGTCGAT
CCAGAAGTATTTCCAACTTGTGAGTTCGAATGGTTTGCTGAATTTGAAACTGATGTACTTGCTGAAGCTG
AGGCGCTTGTGCTTGCTAAAGCTGAGGCTGAGGCACTTGTTGATGCGGATTCAGATGCTGATGTGCTTGC
AGATACTGAAGCCGAAGCACTCGTTGACGCTGAAGCTGAAGCACTTGTTGAGGCTGATGCTGAGGCGCTA
GTACTTGCTGAGGCTGAAGCACTTGTTGATGCTGAAGCTGACGCACTCGTTGAGGCTGAGGCTGAAGCAC
TTGTTGATGCGGATGCTGACGCACTGGTTGATGCCGATTCAGAGGCACTGGTTGATGCGGATTCAGACGC
ACTTGTGCTTGCTGAGGCCGAGGCACTGGTTGATGCGGATTCAGAGGCACTGGTACTTGCTGACTCTGAT
GCACTTGTACTTGCTGAGGCTGAGGCGCTGGTTGACGCTGAAGCCGACGCACTCGTTGATGCGGAAGCTG
ACGCACTGGTGCTTGCTGAAGCCGAGGCACTGGTTGATGCGGATTCAGAGGCACTGGTTGACGCTGAGAC
TGAAGCACTTGTTGATGCTGAGGCCGAGGCGCTGGTTGACGCTGAAGCTGATGCACTCGTTGATGCTGAC
TCAGACGCACTGGTTGACGCTGATTCAGATGCTGAGGTGCTTGCTGAAGCTGACGCACTGGTTGACGCTG
AGACTGAAGCACTCGTTGAGGCCGATTCAGACGCTGAGGTGCTTGCTGAAGCTGATGCACTGGTACTTGC
TGAGGCCGAGGCACTCGTTGATGCTGAAGCTGACGCACTGGTTGACGCTGAAACTGAAGCACTCGTTGAG
GCCGATTCAGACGCTGAGGTGCTTGCTGAAGCTGATGCACTCGTTGAGGCCGATTCAGAAGCTGAGGTAC
TTGCTGAAGCTGAAGCACTCGTTGATGCTGATTCAGATGCTGAGGTGCTTGCTGAGGCTGACGCACTTGT
TGATGCCGATTCAGAGGCACTTGTCGACGCTGAAGCCGAAGCACTGGTTGATGCTGAGGCTGACGCACTT
GTACTTGCTGAAGCTGAGGCACTTGTCGATGCTGAGGCTGAGGCACTCGTTGACGCTGAAGCTGAGGCGC
TGGTACTTGCTGAAGCTGACGCACTGGTTGACGCTGAAGCCGACGCACTCGTTGATGCTGAGGCCGAGGC
GCTGGTTGACGCTGAAGCTGAGGCACTCGTTGATGCTGACTCAGACGCACTGGTTGACGCTGATTCAGAT
GCTGAGGTGCTTGCTGAGGCTGACGCACTGGTTGATGCCGATTCAGAGGCACTTGTCGACGCTGAAGCCG
AAGCACTGGTTGATGCTGAGGCTGACGCACTTGTACTTGCTGAAGCTGACGTACTTGCACTTGTTGATGC
GGATTCAGAAGCTGATGTGCTTGCTGAGGCCGACGCACTGGTTGACGCTGAAGCTGACGCACTCGTTGAT
GCTGAGGCTGAGGCAGACGTTGATGCAGATTCAGACGCTGAGGTGCTTGCTGAAGCCGACGCACTCGTTG
AGGCTGAGGCACTTGTACTTGCTGAAGCTGAGGCACTCGTTGATGCTGAGACTGACGCACTCGTTGATGC
GGAAGCTGAGGCACTTGTTGATGCTGAGGCTGACGCACTTGTACTTGCTGAAGCTGACGTACTTGCACTT
GTTGATGCGGATTCAGAAGCTGATGTGCTTGCTGAGGCCGACGCACTGGTTGACGCTGAAGCTGACGCAC
TCGTTGATGCGGAAGCTGACGCACTCGTTGATGCTGAGGCTGACGCACTTGTACTTGCTGAAGCTGATGC
ACTTGTGCTTGCTGAGGCTGACGCACTTGTACTTGCTGAAGCTGATGCACTTGTGCTTGCTGAGGCTGAC
GCACTGGTTGACGCTGACTCAGAAGCTGATGTGCTTGCTGAGGCTGATGCACTTGTTGATGCTGAAGCCG
ATGCACTTGTTGATGCTGAAGCTGAGGCGCTTGTGCTTGCTGAAGCCGAAGCACTGGTGCTTGCTGAAGC
CGATGCACTCGTTGATGCGGAAGCTGATGCACTAGTACTTGCTGAGGCTGACGCACTGGTTGACGCTGAA
GCTGAGGCGCTTGTGCTTGCTGAAGCCGAAGCACTGGTGCTTGCTGAAGCCGATGCACTCGTTGATGCGG
AAGCTGACGCACTGGTACTTGCTGACTCTGATGCACTGGTTGACGCTGAAGCCGATGCACTCGTTGATGC
TGAAGCCGACGCACTGGTGCTTGCTGAAGCCGATGCACTTGTTGATGCGGATTCAGAGGCACTTGTTGAT
GCTGAAGCCGATGCACTTGTTGATGCTGAAGCTGAGGCGCTTGTGCTTGCTGAAGCCGAAGCACTGGTGC
TTGCTGAAGCCGAAGCACTCGTTGATGCTGAAGCTGACGCACTCGTTGATGCTGACTCAGACGCACTCGT
TGACGCTGAAGCCGAAGCACTTGTACTTGCTGAGGCGCTAGTACTTGCTGAAGCTGATGCACTCGTTGAT
GCTGAAGCTGATGCACTAGTACTTGCTGAGGCTGACGCACTGGTTGATGCTGAAGCTGACGCACTTGTAC
TTGCTGAGGCTGAGGCAGACGTTGATGCGGATTCAGAAGCTGATGTGCTTGCTGAAGCTGAAGCACTTGT
CGATGCTGAAGCTGAGGCGCTGGTACTTGCTGAGGCTGAGGCACTGGTTAATGCTGAAGCTGATGTGCTT
GCTGAAGCTGACGCACTGGTTGACGCTGACTCAGAGGCGCTTGTGCTTGCTGAAGCTGACGCACTGGTAC
TTGCTGAGGCTGAGGCGCTGGTTGACGCTGAAGCTGAAGCACTTGTTGATGCGGAAGCTGATGCACTAGT
ACTTGCTGAAGCTGACGCACTGGTACTTGCTGAGGCTGAGGCAGACGTTGATGCGGATTCAGACGCACTG
GTGCTTGCTGAGGCCGAGGCACTGGTTGACGCTGAGACTGAAGCACTTGTTGATGCTGAGGCTGAGGCGC
TAGTACTTGCTGAAGCCGAAGCACTGGTGCTTGCTGAAGCCGAAGCACTCGTTGATGCTGAAGCTGATGC
ACTAGTACTTGCTGAAGCCGATGCACTGGTTGATGCGGATTCAGAGGCACTGGTTGACGCTGAGACTGAA
GCACTTGTTGATGCTGAGGCTGAGGCGCTAGTACTTGCTGAAGCCGAAGCACTGGTGCTTGCTGAGGCTG
ACGCACTGGTTGACGCTGAAGCCGACGCACTGGTTGACGCTGAAGCTGAAGCACTTGTCGATGCTGAAGC
CGACGCACTGGTGCTTGCTGAAGCTGACGCACTTGTTGATGCGGAAGCCGAAGCACTCGTTGACGCTGAA
GCTGACGCACTGGTACTTGCTGAAGCCGAAGCACTCGTTGATGCGGATTCAGACGCACTTGTTGATGCTG
AAGCCGATGCACTTGTTGATGCTGAGGCTGAGGCACTCGTTGATGCGGATTCAGATGCTGATGTGCTTGC
AGATACTGAAGCCGAAGCACTCGTTGACGCTGAAGCTGATGCACTAGTACTTGTTGACGCCGATGTGCTT
GCACTTGTCGATGCTGACGTGCTTGCCGATGTACTTGCGCTTGTTGATGCTGACGTGCTTGCTGAAGCCG
AAGCACTGGTACTTGCTGAAGCCGAAGCACTGGTTGATGCGGAAGCTGAGGCGCTCGTTGATGCCGATTC
AGACGCTGAGGTGCTTGCTGAGGCTGACGCGCTAGTGCTTGCTGAAGCCGACGCACTGGTTGATGCTGAA
GCTGAAGCGCTTGTCGATGCTGAGGCTGAGGCGCTGGTTGACGCTGAAGCTGAAGCACTGGTTGATGCGG
ATTCAGATGCTGATGTGCTTGCCGAAGCTGACGCACTTGTCGATGCTGAGGCTGACGCACTTGTACTTGC
TGAAGCTGATGCACTTGTGCTTGCTGAGGCTGACGCACTGGTTGATGCCGATTCAGAGGCACTTGTCGAC
GCTGAAGCCGAAGCACTGGTTGATGCTGAGGCTGAAGCGCTTGTCGATGCTGAAGCCGAAGCACTCGTTG
ATGCTGAAGCCGAGGCACTTGTCGATGCTGAGGCTGAGGCAGACGTTGATGCTGAAGCCGAGGCGCTGGT
TGACGCGGATGCTGAGGCGCTGGTGCTTGCTGAAGCCGACGCACTGGTTGACGCTGATTCAGATGCTGAT
GTGCTTGCTGAAGCCGAGGCACTGGTTGACGCTGAAGCCGACGCACTTATTGATGCAGATTCAGAAGCTG
ATGTACTTGCTGAAGCCGAGGCACTGGTTGACGCTGAAGCTGACGCACTGGTTGACGCTGAGGCTGAGGC
GCTAGTACTTGCTGATGCTGAAGCACTTGTTGATGCTGAAGCCGACGCACTGGTTGATGCGGAAGCTGAC
GCACTCGTTGATGCGGAAGCCGACGCACTCGTTGATGCGGAAGCTGAAGCACTTGTTGATGCGGAAGCTG
ACGCACTGGTACTTGCTGAAGCCGAAGCACTCGTTGATGCTGAAGCTGATGCACTGGTTGATGCCGATTC
AGACGCTGAGGTACTGGTACTTGCTGAGGCTGAGGCGCTGGTTGACGCTGAGGCTGACGCACTCGTTGAT
GCCGATTCAGACGCTGAGATACTTGCTGAGGCTGATGCACTGGTTGATGCTGAGGCTGAGGCGCTAGTAC
TTGCTGACTCTGATGCACTGGTTAATGCTGAAGCTGATGTGCTTGCTGAAGCTGACGCACTGGTTGACGC
TGACTCAGAGGCGCTTGTGCTTGCTGAAGCTGACGCACTGGTACTTGCTGAGGCTGAGGCGCTGGTTGAC
GCTGAAGCTGAAGCACTTGTTGATGCGGAAGCTGATGCACTAGTACTTGCTGAAGCTGACGCACTGGTAC
TTGCTGAGGCTGAGGCAGACGTTGATGCGGATTCAGACGCACTGGTGCTTGCTGAGGCCGAGGCACTGGT
TGACGCTGAGACTGAAGCACTTGTTGATGCTGAGGCTGAGGCGCTAGTACTTGCTGAAGCCGAAGCACTG
GTGCTTGCTGAAGCCGAAGCACTCGTTGATGCTGAAGCTGATGCACTAGTACTTGCTGAAGCCGATGCAC
TGGTTGATGCGGATTCAGAGGCACTGGTTGACGCTGAGACTGAAGCACTTGTTGATGCTGAGGCTGAGGC
GCTAGTACTTGCTGAAGCCGATGCACTTGTTGATGCTGAGGCTGAGGCACTCGTTGATGCGGATTCAGAT
GCTGATGTGCTTGCAGATACTGAAGCCGAAGCACTCGTTGACGCTGAAGCTGATGCACTAGTACTTGTTG
ACGCCGATGTGCTTGCACTTGTCGATGCTGACGTGCTTGCCGATGTACTTGCGCTTGTTGATGCTGACGT
GCTTGCTGAAGCCGAAGCACTGGTACTTGCTGAAGCCGAAGCACTGGTTGATGCGGAAGCTGAGGCGCTC
GTTGATGCCGATTCAGACGCTGAGGTGCTTGCTGAGGCTGACGCGCTAGTGCTTGCTGAAGCCGACGCAC
TGGTTGATGCTGAAGCTGAAGCGCTTGTCGATGCTGAGGCTGAGGCGCTGGTTGACGCTGAAGCTGAAGC
ACTGGTTGATGCGGATTCAGATGCTGATGTGCTTGCCGAAGCTGACGCACTTGTCGATGCTGAGGCTGAC
GCACTTGTACTTGCTGAAGCTGATGCACTTGTGCTTGCTGAGGCTGACGCACTGGTTGATGCCGATTCAG
AGGCACTTGTCGACGCTGAAGCCGAAGCACTGGTTGATGCTGAGGCTGAAGCGCTTGTCGATGCTGAAGC
CGAAGCACTCGTTGATGCTGAAGCCGAGGCACTTGTCGATGCTGAGGCTGAGGCAGACGTTGATGCTGAA
GCCGAGGCGCTGGTTGACGCGGATGCTGAGGCGCTGGTGCTTGCTGAAGCCGACGCACTGGTTGACGCTG
ATTCAGATGCTGATGTGCTTGCTGAAGCCGAGGCACTGGTTGACGCTGAAGCCGACGCACTTATTGATGC
AGATTCAGAAGCTGATGTACTTGCTGAAGCCGAGGCACTGGTTGACGCTGAAGCTGACGCACTGGTTGAC
GCTGAGGCTGAGGCGCTAGTACTTGCTGATGCTGAAGCACTTGTTGATGCTGAAGCCGACGCACTGGTTG
ATGCGGAAGCTGACGCACTCGTTGATGCGGAAGCCGACGCACTCGTTGATGCGGAAGCTGAAGCACTTGT
TGATGCGGAAGCTGACGCACTGGTACTTGCTGAAGCCGAAGCACTCGTTGATGCTGAAGCTGATGCACTG
GTTGATGCCGATTCAGACGCTGAGGTACTGGTACTTGCTGAGGCTGAGGCGCTGGTTGACGCTGAGGCTG
ACGCACTCGTTGATGCCGATTCAGACGCTGAGATACTTGCTGAGGCTGATGCACTGGTTGATGCTGAGGC
TGAGGCGCTAGTACTTGCTGACTCTGATGCACTGGTTAATGCTGAAGCTGATGTGCTTGCTGAAGCTGAC
GCACTGGTTGACGCTGACTCAGAGGCGCTTGTGCTTGCTGAAGCTGACGCACTGGTACTTGCTGAGGCTG
AGGCGCTGGTTGACGCTGAAGCTGAAGCACTTGTTGATGCGGAAGCTGATGCACTAGTACTTGCTGAAGC
TGACGCACTGGTACTTGCTGAGGCTGAGGCAGACGTTGATGCGGATTCAGACGCACTGGTGCTTGCTGAA
GCCGAAGCACTCGTTGATGCTGAAGCTGATGCACTAGTACTTGCTGAAGCCGATGCACTGGTTGATGCGG
ATTCAGAGGCACTGGTTGACGCTGAGACTGAAGCACTTGTTGATGCTGAGGCTGAGGCGCTAGTACTTGC
TGAAGCCGAAGCACTGGTGCTTGCTGAGGCTGACGCACTGGTTGACGCTGAAGCCGACGCACTGGTTGAC
GCTGAAGCTGAAGCACTTGTCGATGCTGAAGCCGACGCACTGGTGCTTGCTGAAGCTGACGCACTTGTTG
ATGCGGAAGCCGAAGCACTCGTTGACGCTGAAGCTGACGCACTGGTACTTGCTGAAGCCGAAGCACTCGT
TGATGCGGATTCAGACGCACTTGTTGATGCTGAAGCCGATGCACTTGTTGATGCTGAGGCTGAGGCACTC
GTTGATGCGGATTCAGATGCTGATGTGCTTGCAGATACTGAAGCCGAAGCACTCGTTGACGCTGAAGCTG
ATGCACTAGTACTTGTTGACGCCGATGTGCTTGCACTTGTCGATGCTGACGTGCTTGCCGATGTACTTGC
GCTTGTTGATGCTGACGTGCTTGCTGAAGCCGAAGCACTGGTACTTGCTGAAGCCGAAGCACTGGTTGAT
GCGGAAGCTGAGGCGCTCGTTGATGCCGATTCAGACGCTGAGGTGCTTGCTGAGGCTGACGCGCTAGTGC
TTGCTGAAGCCGACGCACTGGTTGATGCTGAAGCTGAAGCGCTTGTCGATGCTGAGGCTGAGGCGCTGGT
TGACGCTGAAGCTGAAGCACTGGTTGATGCGGATTCAGATGCTGATGTGCTTGCCGAAGCTGACGCACTT
GTCGATGCTGAGGCTGACGCACTTGTACTTGCTGAAGCTGATGCACTTGTGCTTGCTGAGGCTGACGCAC
TGGTTGATGCCGATTCAGAGGCACTTGTCGACGCTGAAGCCGAAGCACTGGTTGATGCTGAGGCTGAAGC
GCTTGTCGATGCTGAAGCCGAAGCACTCGTTGATGCTGAAGCCGAGGCACTTGTCGATGCTGAGGCTGAG
GCAGACGTTGATGCTGAAGCCGAGGCGCTGGTTGACGCGGATGCTGAGGCGCTGGTGCTTGCTGAAGCCG
ACGCACTGGTTGACGCTGATTCAGATGCTGATGTGCTTGCTGAAGCCGAGGCACTGGTTGACGCTGAAGC
CGACGCACTTATTGATGCAGATTCAGAAGCTGATGTACTTGCTGAAGCCGAGGCACTGGTTGACGCTGAA
GCTGACGCACTGGTTGACGCTGAGGCTGAGGCGCTAGTACTTGCTGATGCTGAAGCACTTGTTGATGCTG
AAGCCGACGCACTGGTTGATGCGGAAGCTGACGCACTCGTTGATGCGGAAGCCGACGCACTCGTTGATGC
GGAAGCTGAAGCACTTGTTGATGCGGAAGCTGACGCACTGGTACTTGCTGAAGCCGAAGCACTCGTTGAT
GCTGAAGCTGATGCACTGGTTGATGCCGATTCAGACGCTGAGGTACTGGTACTTGCTGAGGCTGAGGCGC
TGGTTGACGCTGAGGCTGACGCACTCGTTGATGCCGATTCAGACGCTGAGATACTTGCTGAGGCTGATGC
ACTGGTTGATGCTGAGGCTGAGGCGCTAGTACTTGCTGACTCTGATGCACTGGTTGATGCGGATTCAGAG
GCACTGGTTGACGCTGAGACTGAAGCACTCGTTGATGCTGAAGCCGACGCACTGGTACTTGCTGAAGCTG
AAGCACTTGTTGATGCTGAGGCTGAGGCGCTAGTACTTGCTGAAGCCGAAGCACTGGTGCTTGCTGAAGC
TGACGCACTTGTTGATGCGGAAGCCGAAGCACTCGTTGACGCTGAAGCTGACGCACTGGTACTTGCTGAA
GCCGAAGCACTCGTTGATGCGGATTCAGACGCACTTGTTGATGCTGAAGCCGATGCACTTGTTGATGCTG
AGGCTGAGGCACTCGTTGATGCGGATTCAGATGCTGATGTGCTTGCAGATACTGAAGCCGAAGCACTCGT
TGACGCTGAAGCTGATGCACTAGTACTTGTTGACGCCGATGTGCTTGCACTTGTCGATGCTGACGTGCTT
GCCGATGTACTTGCGCTTGTTGATGCTGACGTGCTTGCTGAAGCCGAAGCACTGGTACTTGCTGAAGCCG
AAGCACTGGTTGATGCGGAAGCTGAGGCGCTCGTTGATGCCGATTCAGACGCTGAGGTGCTTGCTGAGGC
TGACGCGCTAGTGCTTGCTGAAGCCGACGCACTGGTTGATGCTGAAGCTGAAGCGCTTGTCGATGCTGAG
GCTGAGGCGCTGGTTGACGCTGAAGCTGAAGCACTGGTTGATGCGGATTCAGATGCTGATGTGCTTGCCG
AAGCTGACGCACTTGTCGATGCTGAGGCTGACGCACTTGTACTTGCTGAAGCTGATGCACTTGTGCTTGC
TGAGGCTGACGCACTGGTTGATGCCGATTCAGAGGCACTTGTCGACGCTGAAGCCGAAGCACTGGTTGAT
GCTGAGGCTGAAGCGCTTGTCGATGCTGAAGCCGAAGCACTCGTTGATGCTGAAGCCGAGGCACTTGTCG
ATGCTGAGGCTGAGGCAGACGTTGATGCTGAAGCCGAGGCGCTGGTTGACGCGGATGCTGAGGCGCTGGT
GCTTGCTGAAGCCGACGCACTGGTTGACGCTGATTCAGATGCTGATGTGCTTGCTGAAGCCGAGGCACTG
GTTGACGCTGAAGCCGACGCACTTATTGATGCAGATTCAGAAGCTGATGTACTTGCTGAAGCCGAGGCAC
TGGTTGACGCTGAAGCTGACGCACTGGTTGACGCTGAGGCTGAGGCGCTAGTACTTGCTGATGCTGAAGC
ACTTGTTGATGCTGAAGCCGACGCACTGGTTGATGCGGAAGCTGACGCACTCGTTGATGCGGAAGCCGAC
GCACTCGTTGATGCGGAAGCTGAAGCACTTGTTGATGCGGAAGCTGACGCACTGGTACTTGCTGAAGCCG
AAGCACTCGTTGATGCTGAAGCTGATGCACTGGTTGATGCCGATTCAGACGCTGAGGTACTGGTACTTGC
TGAGGCTGAGGCGCTGGTTGACGCTGAGGCTGACGCACTCGTTGATGCCGATTCAGACGCTGAGATACTT
GCTGAGGCTGATGCACTGGTTGATGCTGAGGCTGAGGCGCTAGTACTTGCTGACTCTGATGCACTGGTTG
ATGCGGATTCAGAGGCACTGGTTGACGCTGAGACTGAAGCACTCGTTGATGCTGAAGCCGACGCACTGGT
ACTTGCTGAAGCTGAAGCACTTGTTGATGCTGAAGCTGATGCACTCGTTGATGCTGAAGCCGAGGCACTT
GTTGATGCTGATTCAGACGCTGAGATACTTGCTGAGGCTGATGCACTGGTTGATGCTGAGGCTGAGGCGC
TGGTTGATGCCGATTCAGACGCTGAGATACTTGCTGAGGCTGAGGCGCTTGTACTTGCTGAAGTCGACGC
ACTGGTTGAGGCCGATTCAGATGCTGACGTACTTGCACTTGTTGACGCCGATGTGCTTGCACTTGTCGAT
GCTGACGTGCTTGCCGATGTACTTGTGCTTGTTGATGCTGACGTGCTTGCTGAAGCCGAAGCACTGGTGC
TTGCTGAGGCTGACGCACTCGTTGATGCTGAAGCTGAAGCACTCGTTGATGCCGATTCAGACGCTGAGGT
ACTTGCTGAAGCCGACGCTGACGCACTCGTTGATGCTGAGGCTGAGGCACTTGTACTTGCTGATGCCGAA
GCACTCGTTGATGCGGAAGCCGAGGCACTGGTTGACGCTGAAGCCGACGCACTCGTTGATGCGGAAGCTG
ACGCACTGGTTGACGCTGAAGCTGAAGCACTGGTACTTGCTGATGCCGAAGCACTCGTTGATGCTGAGGC
TGAGGCGCTGGTACTTGCTGAGGCTGACGCACTCGTTGATGCGGATTCAGACGCACTCGTTGAGGCTGAT
TCAGATGCTGAGGTGCTTGCTGAAGCCGAAGCACTCGTTGATGCTGAGGCTGACGCACTGGTTGATGCTG
AAGCTGAAGCACTTGTACTTGCTGAGGCTGAGGCAGACGTTGATGCGGATTCAGAAGCTGATGTGCTTGC
TGAAGCTGACGCACTTGTCGATGCTGAAGCTGAGGCGCTGGTACTTGCTGAGGCTGATGCACTGGTTGAT
GCTGAAGCTGATGCACTTGTTGATGCTGAAGCTGACGCACTCGTTGACGCTGAAGCTGAGGCGCTTGTGC
TTGCTGAAGCCGAAGCACTGGTGCTTGCTGAAGCCGATGCACTCGTTGATGCGGAAGCTGACGCACTGGT
ACTTGCTGACTCTGATGCACTGGTTGACGCTGAAGCCGATGCACTCGTTGATGCTGAAGCCGACGCACTG
GTGCTTGCTGAAGCCGATGCACTTGTTGATGCGGATTCAGAGGCACTTGTTGATGCTGAAGCCGATGTAC
TTGTTGATGCTGAAGCTGAGGCGCTTGTGCTTGCTGAAGCCGAAGCACTGGTGCTTGCTGAAGCCGAAGC
ACTCGTTGATGCTGAAGCTGACGCACTCGTTGATGCTGACTCAGACGCACTCGTTGACGCTGAAGCCGAA
GCACTTGTACTTGCTGAGGCGCTAGTACTTGCTGAAGCTGATGCACTCGTTGATGCTGAAGCTGATGCAC
TAGTACTTGCTGAAGCTGAAGCACTCGTTGATGCAGATTCAGACGCTGAGGTGCTTGCTGAGGCTGAAGC
ACTTGTTGACGCTGAAGCCGACGCACTGGTTGATGCTGAAGCTGACGCACTGGTACTTGCTGAGGCTGAG
GCGCTGGTTGACGCTGAAGCTGACGCACTGGTACTTGCTGACTCTGATGCACTGGTTGACGCTGAAGCCG
AAGCACTCGTTGATGCTGAAGCTGATGCACTAGTACTTGCTGAGACTGACGCACTCGTTGATGCCGATTC
AGACGCTGAGGTACTTGCTGAAGCCGAAGCACTCGTTGATGCCGATGTACTTGCTGACGTACTTGCGCTT
GTTGATGCGGACGTGCTTGCTGACGTACTTGCGCTTGTTGATGCGGACGTACTTGCTGACGTACTTGCGC
TTGTTGATGCTGACGTGCTTGCTGACGTACTTGCGCTTGTTGATGCGGACGTACTTGCTGAGGTCGACGC
GCTTGTTGACGCCGATGTACTTGCTGACGTGCTTGCTGAAGCCGACGCACTCGTTGATGCCGATTCAGAC
GCTGAGGCGCTTTGACTAGCACTTACTGAGAGTGACTTAGACTGTGAAAGTGACTGACTGGTCGTGCTAG
ATTCAACTATCTTTCCTTTACTATTGAAGTAGTTAGTTCTAATTTTATCTGTTTTAGCAGCGTAAGGGGT
AAATGTAAAGGATGTATCCGTTCCAGTAATTGGTACAGTCCAAGATGATGTTAATCCATATCCTCGCTTA
GCAAATAAACCATTCATTTGGGCACCATTTCCCCAAGTATACCCACTACCCTGCGTCGTCATTGTAGACA
TATTATAGTATTGAACCTGTACACCATCTTTGTCAGTAATGTAGTTCTTTACACTTGAAGGTGTTTTCAA
TCCCTTTCCTAACGTTAACATCGTTTGATAAATTGTTCCTGTATTATAGATAGAATATCCACGAGACATT
CTTGAAAGATTTCCAAGAGTCTTTGTGATAGGATCTACATACGTAACCGTATAGGTAAAGGTCAATTTTG
AACCATCATTTGTCACTGTCAATTTATAGTAAATTGGAATATTATAAAATGAATCTCTACCTGTACCCGT
GTAAATTTTTGTCTCACTTTTAGCAATGTTTAGACTTGCATTAATTGCAGGGGCGCCATTTACAATCGTA
TTGCCAGAAAAAACAGCAGCATTTATAGAAGCCAGCAATTGCTCGATGGAATCTACTGAACGCTTGCGTC
GCTTAGCATAAGATTGGAGATTGACATTTGTAACTGATGCTACATAATCACTAGCTGGTTTCTTACGATC
TTCTTCGACCTTCTTAGCAGTTGCTTCTGTAGCGGCAGCTGTTTGTGAACCTACCACAGTAGATGATGCA
GAAATACTTGTCGAAGCCGATGTACTTGCTGATTCTGATGCACTTGTACTCGCTGAGGTCGAAGCGCTGG
TTGAGGCTGACTCAGATGCAGATGTACTTGCCGACTCTGAAGCTGACAAACTAGTTGAACTCGCTGAATT
ACTTGTAGATATCGTACCTAGAACTACTGTATCATTTGTTGCCAAAGCATCCGTTTTCTCTACAGTTTTT
TCAAGTACTGCCGACTCATTTGTAAATACCTTCGTTTGAGTTGCAACGGTTCCACTTATGACAGTTCCCG
CAGCAACTATCCCCTTGAGGATATCAAGCCCAGTAATTGAATGACTTACTTTATCTTCTACCGTTTCGGT
CA

Protein Sequence
>YP_002511663.1 modified cell wall surface anchored protein contain S-SRR1-BR region[Streptococcus pneumoniae ATCC 700669]
MTETVEDKVSHSITGLDILKGIVAAGTVISGTVATQTKVFTNESAVLEKTVEKTDALATNDTVVLGTIST
SNSASSTSLSASESASTSASESASTSASTSASTSASESASTSASTSISASSTVVGSQTAAATEATAKKVE
EDRKKPASDYVASVTNVNLQSYAKRRKRSVDSIEQLLASINAAVFSGNTIVNGAPAINASLNIAKSETKI
YTGTGRDSFYNIPIYYKLTVTNDGSKLTFTYTVTYVDPITKTLGNLSRMSRGYSIYNTGTIYQTMLTLGK
GLKTPSSVKNYITDKDGVQVQYYNMSTMTTQGSGYTWGNGAQMNGLFAKRGYGLTSSWTVP
Molecule Role Protective antigen
Molecule Role Annotation Mice immunized with recombinant (r)PsrP(BR) had significantly less bacteria in their blood and improved survival versus controls following intranasal challenge (Shivshankar et al., 2009).
References