VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MIC10

Gene Name MIC10
Sequence Strain (Species/Organism) Neospora caninum
VO ID VO_0011198
NCBI Protein GI 11141617
Taxonomy ID 29176
Gene Strand (Orientation) ?
Protein Name NcMIC10 precursor
Protein pI 9.31
Protein Weight 23276.72
Protein Length 251
Protein Sequence
>AAG32025.1 NcMIC10 precursor [Neospora caninum]
MALSTMNKPGPFRRLLGYGLLLGAVVLEAAFDLSAPAEAVALRRLDQKETVQALVEQHRFSNDYDQEAEY
RRRRQELGSQTPEEIEEAKRKYRKQVLKEQQEDEELKKKTDAVIEELKKTAEERGLRRYPERDEDRTDDQ
QMDFETRQRELRNMDSATKAQLLKQRRKENEERNRVKRNSDDVMAELKQKLAARKKAM

Molecule Role Protective antigen
Molecule Role Annotation This study used an immunisation/challenge model of transplacental transmission, based on the Qs mouse with an Nc-Liverpool challenge to investigate the vaccine potential of a number of formulations based on four recombinant proteins of N. caninum. A mixture of MIC10 and p24B produced partial protection against transplacental transmission of N. caninum in this mouse model (Ellis et al., 2008).

Note: MIC10 must be used in conjunction with p24B in order to confer protection against N. caninum.
Related Vaccines(s) N. caninum MIC10 and p24 protein vaccine
References