VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MIC1

Gene Name MIC1
Sequence Strain (Species/Organism) Neospora caninum
VO ID VO_0011200
NCBI Protein GI 17226315
Other Database IDs CDD:287526
CDD:151915
Taxonomy ID 29176
Gene Strand (Orientation) ?
Protein Name microneme-associated protein
Protein pI 4.56
Protein Weight 45856.53
Protein Length 528
Protein Note Sialic-acid binding micronemal adhesive repeat; pfam10564
Protein Sequence
>AAL37729.1 microneme-associated protein [Neospora caninum]
MGQSVVFVMLLSVIFTAGAKTYGEASQPSASARSLQGALDTWCQEVFKKLCDDGYSKMCIPANQVVARQG
LGRKDQQKLVWRCYDSAAFLAEGDENNVLSCVDDCGVSIPCPGGVDRDNSTHATRHDELSQLIKEGVVRY
CSGFQAAANSYCNKRYPGTVARKSKGFGHKEPVKWRCYKPESLLFSVFSECVSNCGTTWSCPGGRLGTAT
NLDKKHFTDESGILQALTSVPKACPVGLVCLPRDQNPPACLDDNGNVPEEEGGQPVQPRDTKLPVDDSEP
TDESETTPGGGDDQPSPKEDGDTDSPDEGDQSGGSEWYKQIPEIRVIGDSLQAMLHAGQQLMVTYSSPQL
HVSVGSCHKLTVNFSDYYLSFDTTSKSGSDEVELDDAAGSGELTIGLGSSGRVTVVFQYATNGGGNRYVA
YTVGDSGCKTIEAVLLHGLNPGAKLVRNTIGDNSPGESEL

Molecule Role Protective antigen
Molecule Role Annotation Study assessed the potential protectivity of NcMIC1-based vaccination against experimental N. caninum infection in mice. Quantitative real-time PCR revealed that the infection intensity was significantly reduced in the group vaccinated with recNcMIC1 antigen. Serological analysis showed that only recNcMIC1-immunized animals generated detectable antibody levels recognizing native NcMIC1. Thus, of all protocols applied, only recNcMIC1 vaccination appears to be suited to reduce cerebral infection in mice challenged with N. caninum tachyzoites (Alaeddine et al., 2005).
Related Vaccines(s) N. caninum NcMIC1 Protein Vaccine , RB51--MIC3/GRA6/MIC1/SRS2
References