VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

CbpA

Gene Name CbpA
Sequence Strain (Species/Organism) Streptococcus pneumoniae D39
VO ID VO_0011203
NCBI Gene ID 4441159
NCBI Protein GI 116515359
Locus Tag SPD_2017
Genbank Accession CP000410
Protein Accession YP_817402
3D structure: PDB ID 1W9R
Taxonomy ID 373153
Gene Starting Position 1995043
Gene Ending Position 1997148
Gene Strand (Orientation) -
Protein Name choline binding protein A
Protein pI 8.27
Protein Weight 75722.56
Protein Length 701
Protein Note equivalent gene in S.pneumoniae R6 = spr1995 This gene is also called SpsA, pspC (pneumococcal surface protein C)and Hic; identified by match to protein family HMM PF01473; match to protein family HMM PF04650; match to protein family HMM PF05062; match to protein family HMM TIGR01168
DNA Sequence
>NC_008533.1:1995043-1997148 Streptococcus pneumoniae D39, complete genome
TTTAGTTTACCCATTCACCATTGGCATTGACTCCATAGCCATCTACAGTTGTGTTGACTGCAAGGGCACC
TGAGCCATTGACATAGTACCATTTATCTGATACTTTGAACCATTGGCTTGCTTTCATAGCACCTGATGCT
TCAAGATAGTACCAGGTATCTCCATCTTTCACCCAACCTGTCGCCATATCACCATTAGCGTTGAGGTAAT
ACCATGAACCGTTGTATTGGAGCCATCCTGTCGCCATATCACCATTAGCGTTGAGGTAGTACCATGAACC
GTTGTTTTGGAGCCATCCTGTCGCCATATCACCATTAGCGTTGAGGTAGTACCATGAGCCATTGTATTGG
AGCCATCCTGTCGCCATAGCGCCATTGCTGTTTAGGTAGTACCATGAACCATTGTATTGGAGCCATCCTG
TCGCCATAGCACCATTAGCGTTTAGGTAGTACCATGAACCATTGTTTTGGAGCCATCCTGTTGCCATTGA
ACCATTAGCGTTTAGATAGTACCATGAACCATTGTTTTGGAGCCATCCTGTCGCCATAGCACCATTAGCG
TTTAGATAGTACCATGAACCGTTGTTTTGGAGCCATCCTGTTGCCATTGAACCATCAGTATTGTAGAAGT
ACCACATACCGTTTTCTTGTTTCCAGCCTGTTTTTGGAGTAGATGGTTGTGCTGGTTTTTCAGTTTTTGG
CGGTTGCTGTTGAGTCAAGCGATTATATTCTTCTTCTGATCTACGAGCATAGTCTTCTTCAGCTTGTTGA
TCATCTGTTTTTTCTGCTTTTGGTTGTTCAGCTGGCTTCTCTGGTTTTGGAGCTGGTTTTTCTGGTTGAG
TAGCCGGCGCTGGTTGTGGTTGTTCAGCTGGTTTTTCTTTAACTTTATCTTCTTCTGCTGCTTTTCGTTT
AGCTTCTTCTTCTGCTTTTTTACGATCTGTCTTGATGTTTTCTAACCTTGTAGCCTCAGCTTTTTTACTC
TCAACTTTCGCTTTTGCTTGCTTAATTTTTTCCTCGTCTCGAGGTTCCTTAGCTTCCTCTTTTACTAGTT
CAAGCTCCGCTTCTTTAACTTTCACATCGGACTCAGCAATTTCAAGGTCAAGCGTTTTGTAAGTATTGGT
TGGGTAGTTACGGCGATCTTCTTCTTTTTGATCCTTGGCTTTTTTCTCAGCTTCTTCAACCTTCTTCTCA
GCTTCTGCTACCTTTTTTCCTGATTTCAGGGATGAGCTTGGAAGAGTTTCTTCACCTACGCTAGAATCTG
AAGACTTCGCATCATTTTCTTTTTTATCAGGTGTTGCTAGCTCTCCAGGAACTCCTCGTTTTGCCCGCCC
CTTTGGTTTACCTTGATCTGAAGTCGCTACATTAGCTTCCTTCAACTTAGCATCTGCTTTTCGTTTAGCT
TCTTCTTCTGCTTTTTTACGATCTGTCTTGATGTTTTCTAACCTTGTAGCCTCAGCTTTTTTACTCTCAA
CTTTCTCTTTTGCTTGCTTAATTGTGCCCTCGTTTCGAGATTCTTTAGCTTCCTCTTTTACTAGTTCAAG
CTCCGCTTCTTTAACTTTCACATCGAACTCAGCAATTTCAAGTTCAAGCGTTTTGTAAGTATTGGTTGGG
TAGTTACGACGATCTTCTTCTTTTTGATCCTCGGCTTTTTTCTTAGCTTCTTCAACCTTCTTCTTAGCTT
CTGCTACCTTTTCTCCTGGTTTCAATGTATCTTTTTTAAACTTCTCAAAAGCTGCGTCTAACTTTGCTTT
TATTTCTGACGGCAACTCATCTTTCGACTTCTCTTCTAAAACATTTAATTCACGCAAATACTTCGTTTTA
ATTGCGCTCAACTTTATGTTTAAGGCGACATTTTGGGTATGTTTTCTTCTATCTAGTTGAATCTCCCTCA
ACATTTTTTCTATATATTCATCGACGACTTGTTTAGCAGCTTTCCTATGTTCTGTCTTTGCCATATTAGA
AGAAGTGGCTGCTTGGGTACTTCCCTCGTTCTCTGTCGCATGAACCACACTTCCCATAACAAGACTGGCA
ACAGCTACACTAGCTACTCCAATACTAAATTTACGAATTGAATAATGTACTTTTCTTTCGCTTTTTGATG
CAAACA

Protein Sequence
>YP_817402.1 choline binding protein A [Streptococcus pneumoniae D39]
MFASKSERKVHYSIRKFSIGVASVAVASLVMGSVVHATENEGSTQAATSSNMAKTEHRKAAKQVVDEYIE
KMLREIQLDRRKHTQNVALNIKLSAIKTKYLRELNVLEEKSKDELPSEIKAKLDAAFEKFKKDTLKPGEK
VAEAKKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAEFDVKVKEAELELVKEEAKESRNEGTIKQAK
EKVESKKAEATRLENIKTDRKKAEEEAKRKADAKLKEANVATSDQGKPKGRAKRGVPGELATPDKKENDA
KSSDSSVGEETLPSSSLKSGKKVAEAEKKVEEAEKKAKDQKEEDRRNYPTNTYKTLDLEIAESDVKVKEA
ELELVKEEAKEPRDEEKIKQAKAKVESKKAEATRLENIKTDRKKAEEEAKRKAAEEDKVKEKPAEQPQPA
PATQPEKPAPKPEKPAEQPKAEKTDDQQAEEDYARRSEEEYNRLTQQQPPKTEKPAQPSTPKTGWKQENG
MWYFYNTDGSMATGWLQNNGSWYYLNANGAMATGWLQNNGSWYYLNANGSMATGWLQNNGSWYYLNANGA
MATGWLQYNGSWYYLNSNGAMATGWLQYNGSWYYLNANGDMATGWLQNNGSWYYLNANGDMATGWLQYNG
SWYYLNANGDMATGWVKDGDTWYYLEASGAMKASQWFKVSDKWYYVNGSGALAVNTTVDGYGVNANGEWV
N

Molecule Role Protective antigen
Molecule Role Annotation Mice were actively immunized with a fragment of choline binding protein A (CbpA; also known as PspC, Hic, and SpsA). CbpA was able to protect mice from intraperitoneal challenge with medium to very high doses of a highly virulent capsular type 2 pneumococcal strain, D39 (Ogunniyi et al., 2001).
Related Vaccines(s) S. pneumoniae CbpA Protein Vaccine
References