VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PiaA

Gene Name PiaA
Sequence Strain (Species/Organism) Streptococcus pneumoniae D39
VO ID VO_0011207
NCBI Gene ID 4442863
NCBI Protein GI WP_000731179
Locus Tag SPD_0226
Genbank Accession CP000410
Protein Accession YP_815744
Other Database IDs CDD:328725
Taxonomy ID 1313
Gene Starting Position 216000
Gene Ending Position 216368
Gene Strand (Orientation) -
Protein Name extracellular solute-binding protein
Protein pI 4.84
Protein Weight 35132.62
Protein Length 424
Protein Note Type 2 periplasmic binding fold superfamily; cl21456
DNA Sequence
>NC_008533.1:216000-216368 Streptococcus pneumoniae D39, complete genome
TTTACTGTTTAGATTGGATATCTGTAAAGACTTCGTTGTATTTCTTAACGATATCTGATTTATTCTTGAT
GACATAATCATAATCTTCAGTGAGTGTTTTGATTTTGTCAATTGGTTTCATGTTTTCGCTTGTTTTAGCA
TTTTTACGAACAGGACGGTTAGTAGTGGTTGTACCAAGTGTATCTTGTACTTCTTGAGAGATAATAAAAT
CGATAAATTTCTTGGCATTTTCCATATTTTTAGATTTTTTAACGATAGCAGCACTAGCAGGTAGGAAGAC
GGTTCCTTCTTTTGGATAGACTACTTTAATGTTAGCTCCGTCATTTAAGAGTTTAACTGCTGAATCTTCA
TAAGAGAGACCAACAGTCA
Protein Sequence
>WP_000731179.1 extracellular solute-binding protein [Streptococcus pneumoniae]
MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATIPAFEEKYGIKVELIQAGTGELFKKL
ESEKEVPVADVIFGGSYTQYTTHGELFENYTSKENDNVIKEYQNTTGYSTPYTLDGSVLIVNPDLTKGMN
IEGYNDLFKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGKIGSSSSSVYK
VVADGEMAVGLSYEDPAVKLLNDGANIKVVYPKEGTVFLPASAAIVKKSKNMENAKKFIDFIISQEVQDT
LGTTTTNRPVRKNAKTSENMKPIDKIKTLTEDYDYVIKNKSDIVKKYNEVFTDIQSKQ
Molecule Role Protective antigen
Molecule Role Annotation Mice immunized with recombinant PiaA were protected against systemic challenge to a degree similar to those immunized with an existing protein vaccine candidate, PdB (a genetically modified pneumolysin toxoid). Immunization with a combination of both PiuA and PiaA resulted in additive protection and was highly protective against systemic infection with S. pneumoniae (Brown et al., 2001).
Related Vaccines(s) S. pneumoniae PiaA Protein Vaccine
References