VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

SERA-5

Gene Name SERA-5
Sequence Strain (Species/Organism) Plasmodium falciparum
VO ID VO_0011210
NCBI Protein GI 238629807
3D structure: PDB ID 3CH2
Other Database IDs CDD:185641
Taxonomy ID 5833
Gene Strand (Orientation) ?
Protein Name serine repeat antigen 5
Protein pI 6.14
Protein Weight 28688.67
Protein Length 362
Protein Note Serine-repeat antigen protein; Provisional
Protein Sequence
>ACR49652.1 serine repeat antigen 5, partial [Plasmodium falciparum]
TGGGQAGNTGGGQAGNTGGGQAGNTVGDQAGSTGGSPQGSTGASQPGSSEPSNPVSSGHSVSTVSVSQTS
TSSEKQDTIQVKSALLKDYMGLKVTGPCNENFIMFLVPHIYIDVDTEDTNIELRTTLKKTNNAISFESNS
GSLEKKKYVKLPSNGTTGEQGSSTGTVRGDTEPISDSSSSSSSSSSSSSSSSSSSSSSSESLPANGPDSP
TVKPPRNLQNICETGKNFKLVVYIKENTLILKWKVYGETKDTTENNKVDVRKYLINEKETPFTNILIHAY
KEHNEQT

Molecule Role Protective antigen
Molecule Role Annotation Researchers constructed a new recombinant molecule of SERA5, namely SE36. Vaccination of Squirrel monkeys with SE36 protein and aluminium hydroxyl gel (SE36/AHG) conferred protection against high parasitemia and boosted serum anti-SE36 IgG after P. falciparum parasite challenge (Horii et al., 2010).
Related Vaccines(s) P. falciparum Subunit SE36 Protein Vaccine
References