>AAC47502.1 merozoite surface protein 1, partial [Plasmodium berghei]
SGQSSTEPASTGTPSSGEVSTGTSTGGASAGVTNTGAATTGTSTGGASAGVTNTGAATTGTTGTGAATTG
TTGAEAVTTGNTGAEVTQVQIVPTLTPEEKKKKMDGLYAQI
Molecule Role
Protective antigen
Molecule Role Annotation
Mice vaccinated with recombinant rMSP1 (rPbMSP1), which was generated from Plasmodium berghei, in alum mounted significant protective immunity against challenge infection (P < 0.01). On day 121 after the booster, three out of ten mice immunized with rPbMSP1 in PBS survived parasite infection (P < 0.05) and eight out of ten mice vaccinated with r MSP1 in alum did (P < 0.01). Hence, immunization with MSP1 in alum obviously has conferred protective effects, which prevented death from P. berghei lethal infection in mice (P < 0.01) (Wan et al., 2007).
