VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

A56R

Gene Name A56R
Sequence Strain (Species/Organism) Vaccinia virus (strain: WR (Western Reserve))
NCBI Gene ID 3707652
Locus Tag VACWR181
DNA Sequence
>gi|335637|gb|M93956.1|VACHGG Vaccinia virus hemagglutinin gene, complete cds
TTGGACATTGGATAATGGTCACGTGTTACCACGCAATTATATAATGTATAAATGCGAACCGATTAAACAT
AAATATCCATTGGAAAAAACACAGTACACGAATGATTTTCTAAAGTATTTGGAAAGTTTTATAGGTAGTT
GATAGAACAAAATACATAATTTTGTAAAAATAAATCACTTTTTATACTAATATGACACGATTACCAATAC
TTTTGTTACTAATATCATTAGTATACGCTACACCTTTTCCTCAGACATCTAAAAAAATAGGTGATGATGC
AACTCTATCATGTAATCGAAATAATACAAATGACTACGTTGTTATGAGTGCTTGGTATAAGGAGCCCAAT
TCCATTATTCTTTTAGCTGCTAAAAGCGACGTCTTGTATTTTGATAATTATACCAAGGATAAAATATCTT
ACGACTCTCCATACGATGATCTAGTTACAACTATCACAATTAAATCATTGACTGCTAGAGATGCCGGTAC
TTATGTATGTGCATTCTTTATGACATCAACTACAAATGACACTGATAAAGTAGATTATGAAGAATACTCC
ACAGAGTTGATTGTAAATACAGATAGTGAATCGACTATAGACATAATACTATCTGGATCTACACATTCAC
CGGAAACTAGTTCTAAGAAACCTGATTATATAGATAATTCTAATTGCTCGTCGGTATTCGAAATCGCGAC
TCCGGAACCAATTACTGATAATGTAGAAGATCATACAGACACCGTCACATACACTAGTGATAGCATTAAT
ACAGTAAGTGCATCATCTGGAGAATCCACAACAGACGAGACTCCGGAACCAATTACTGATAAAGAAGATC
ATACAGTTACAGACACTGTCTCATACACTACAGTAAGTACATCATCTGGAATTGTCACTACTAAATCAAC
CACCGATGATGCGGATCTTTATGATACGTACAATGATAATGATACAGTACCACCAACTACTGTAGGCGGT
AGTACAACCTCTATTAGCAATTATAAAACCAAGGACTTTGTAGAAATATTTGGTATTACCGCATTAATTA
TATTGTCGGCCGTGGCAATATTCTGTATTACATATTATATATATAATAAACGTTCACGTAAATACAAAAC
AGAGAACAAAGTCTAGATTTTTGACTTACATAAATGTCTGGGATAGTAAAATCTATCATATTGAGCGGAC
CATCTGGTTTAGGAAAGACAGCCATAGCCAAAAGACTATGGGAATATATTTGGATTTGTGGTGTCCCATA
CCACTAGATTTCCTCGTCCTATGGAACGAGAAGGTGTTGATTACCATTACGTTAACAGAGAGGCCATCTG
GAAGGGAATAGCCGCCGGAAACTTTCTAGAACATACTGAGTTTTTAGGAAATATTTACGGAACTTCTAAA
ACAGCTGTGAATACACGGCTATTAATAATCGTATTTGTGTGATGGATCTAAACATCGACGGTGTTAGAAG
TCTTAAAAATACGTACCTAATGCCTTACTCGGTGTATATAAGACCTACCTCTCTTAAAATGGTTGAGACC
AAGCTTGGCACTGGCGTCGTTT
Protein Sequence
>gi|335638|gb|AAA48252.1| hemagglutinin
MTRLPILLLLISLVYATPFPQTSKKIGDDATLSCNRNNTNDYVVMSAWYKEPNSIILLAAKSDVLYFDNY
TKDKISYDSPYDDLVTTITIKSLTARDAGTYVCAFFMTSTTNDTDKVDYEEYSTELIVNTDSESTIDIIL
SGSTHSPETSSKKPDYIDNSNCSSVFEIATPEPITDNVEDHTDTVTYTSDSINTVSASSGESTTDETPEP
ITDKEDHTVTDTVSYTTVSTSSGIVTTKSTTDDADLYDTYNDNDTVPPTTVGGSTTSISNYKTKDFVEIF
GITALIILSAVAIFCITYYIYNKRSRKYKTENKV
Related Vaccines(s) LC16m8
References