VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

TBEVgp1 polyprotein

Gene Name TBEVgp1 polyprotein
Sequence Strain (Species/Organism) Tick-borne encephalitis virus
VO ID VO_0011245
NCBI Gene ID 1489719
NCBI Protein GI 9628432
Locus Tag TBEVgp1
Genbank Accession U27495
Protein Accession NP_043135
Taxonomy ID 11084
Gene Starting Position 132
Gene Ending Position 10376
Gene Strand (Orientation) +
Protein Name polyprotein
Protein pI 8.16
Protein Weight 347270.05
Protein Length 3414
DNA Sequence
>NC_001672.1:132-10376 Tick-borne encephalitis virus, complete genome
GATGGTCAAGAAGGCCATCCTGAAAGGTAAGGGGGGCGGTCCCCCTCGACGAGTGTCGAAAGAGACCGCA
ACGAAGACGCGTCAACCCAGAGTCCAAATGCCAAATGGGCTTGTGTTGATGCGCATGATGGGGATCTTGT
GGCATGCCGTAGCCGGCACCGCGAGAAACCCCGTATTGAAGGCGTTCTGGAACTCAGTCCCTCTGAAACA
GGCAACAGCAGCACTGCGGAAGATCAAAAGGACGGTGAGTGCCCTAATGGTTGGCTTGCAAAAACGTGGG
AAAAGGAGGTCAGCGACGGACTGGATGAGCTGGTTGCTGGTCATCACTCTGTTGGGGATGACGCTTGCTG
CAACGGTGAGGAAAGAAAGGGATGGCTCAACTGTGATCAGAGCTGAAGGAAAGGATGCAGCAACTCAGGT
GCGTGTGGAGAATGGCACCTGTGTGATCCTGGCTACTGACATGGGGTCATGGTGTGATGATTCACTGTCC
TATGAGTGTGTGACCATAGATCAAGGAGAAGAGCCTGTTGACGTGGATTGTTTTTGCCGGAACGTTGATG
GAGTCTATCTGGAGTACGGACGCTGTGGGAAACAGGAAGGCTCACGGACAAGGCGCTCAGTGCTGATCCC
ATCCCATGCTCAGGGAGAGCTGACGGGAAGGGGACACAAATGGCTAGAAGGAGACTCGCTGCGAACACAC
CTTACTAGAGTTGAGGGATGGGTCTGGAAGAACAAGCTACTTGCCTTGGCAATGGTTACCGTTGTGTGGT
TGACCCTGGAGAGTGTGGTGACCAGGGTTGCCGTTCTTGTTGTGCTCCTGTGTTTGGCACCGGTTTACGC
TTCGCGTTGCACACACTTGGAAAACAGGGACTTTGTGACTGGTACTCAGGGGACTACGAGGGTCACCTTG
GTGCTGGAACTGGGTGGATGTGTTACTATAACAGCTGAGGGGAAGCCTTCAATGGATGTGTGGCTTGACG
CCATTTACCAGGAGAACCCTGCTAAGACACGTGAGTACTGTTTACACGCCAAGTTGTCGGACACTAAGGT
TGCAGCCAGATGCCCAACAATGGGACCAGCCACTTTGGCTGAAGAACACCAGGGTGGCACAGTGTGTAAG
AGAGATCAGAGTGATCGAGGCTGGGGCAACCACTGTGGACTGTTTGGAAAGGGTAGCATTGTGGCCTGTG
TCAAGGCGGCTTGTGAGGCAAAAAAGAAAGCCACAGGACATGTGTACGACGCCAACAAAATAGTGTACAC
GGTCAAAGTCGAACCACACACGGGAGACTATGTTGCCGCAAACGAGACACATAGTGGGAGGAAGACGGCA
TCCTTCACAATTTCTTCAGAGAAAACCATTTTGACTATGGGTGAGTATGGAGATGTGTCTTTGTTGTGCA
GGGTCGCTAGTGGCGTTGACTTGGCCCAGACCGTCATCCTTGAGCTTGACAAGACAGTGGAACACCTTCC
AACGGCTTGGCAGGTCCATAGGGACTGGTTCAATGATCTGGCTCTGCCATGGAAACATGAGGGAGCGCAA
AACTGGAACAACGCAGAAAGACTGGTTGAATTTGGGGCTCCTCACGCTGTCAAGATGGACGTGTACAACC
TCGGAGACCAGACTGGAGTGTTACTGAAGGCTCTCGCTGGGGTTCCTGTGGCACACATTGAGGGAACCAA
GTACCACCTGAAGAGTGGCCACGTGACCTGCGAAGTGGGACTGGAAAAACTGAAGATGAAAGGTCTTACG
TACACAATGTGTGACAAAACAAAGTTCACATGGAAGAGAGCTCCAACAGACAGTGGGCATGATACAGTGG
TCATGGAAGTCACATTCTCTGGAACAAAGCCCTGTAGGATCCCAGTCAGGGCAGTGGCACATGGATCTCC
AGATGTGAACGTGGCCATGCTGATAACGCCAAACCCAACAATTGAAAACAATGGAGGTGGCTTCATAGAG
ATGCAGCTGCCCCCAGGGGATAACATCATCTATGTTGGGGAACTGAGTCATCAATGGTTCCAAAAAGGGA
GCAGCATCGGAAGGGTTTTCCAAAAGACCAAGAAAGGCATAGAAAGACTGACAGTGATAGGAGAGCACGC
CTGGGACTTCGGTTCTGCTGGAGGCTTTCTGAGTTCAATTGGGAAGGCGGTACATACGGTCCTTGGTGGC
GCTTTCAACAGCATCTTCGGGGGAGTGGGGTTTCTACCAAAACTTTTATTAGGAGTGGCATTGGCTTGGT
TGGGCCTGAACATGAGAAACCCTACAATGTCCATGAGCTTTCTCTTGGCTGGAGGTCTGGTCTTGGCCAT
GACCCTTGGAGTGGGGGCGGATGTTGGTTGCGCTGTGGACACGGAACGAATGGAGCTCCGCTGTGGCGAG
GGCCTGGTCGTGTGGAGAGAGGTCTCAGAATGGTATGACAATTATGCCTACTACCCGGAGACACCGGGGG
CCCTTGCATCAGCCATAAAGGAGACATTTGAGGAGGGAAGCTGTGGTGTAGTCCCCCAGAACAGGCTCGA
GATGGCCATGTGGAGAAGCTCGGTCACAGAGCTGAATTTGGCTCTGGCGGAAGGGGAGGCAAATCTCACA
GTGGTGGTGGACAAGTTTGACCCCACTGACTACCGAGGTGGTGTCCCTGGTTTACTGAAAAAAGGAAAGG
ACATAAAAGTCTCCTGGAAAAGCTGGGGCCATTCAATGATCTGGAGCATTCCTGAGGCCCCCCGTCGCTT
CATGGTGGGCACGGAAGGACAAAGTGAGTGTCCCCTAGAGAGACGGAAGACAGGTGTTTTCACGGTGGCA
GAATTCGGGGTTGGCCTGAGAACAAAGGTCTTCTTGGATTTCAGACAGGAACCAACACATGAGTGTGACA
CAGGAGTGATGGGAGCTGCAGTCAAGAACGGCATGGCAATCCACACAGATCAAAGTCTCTGGATGAGATC
AATGAAAAATGACACAGGCACTTACATAGTTGAACTTTTGGTCACTGACCTGAGGAACTGCTCATGGCCT
GCTAGCCACACTATCGATAATGCTGACGTGGTGGACTCAGAGTTATTCCTTCCGGCGAGCCTGGCAGGAC
CCAGATCCTGGTACAACAGGATACCTGGCTATTCAGAACAGGTGAAAGGGCCATGGAAGTACACGCCTAT
CCGAGTTATCAGAGAGGAGTGTCCCGGCACGACCGTTACCATCAACGCCAAGTGTGACAAAAGAGGAGCA
TCTGTGAGGAGTACCACAGAGAGTGGCAAGGTTATCCCAGAATGGTGCTGCCGAGCGTGCACAATGCCAC
CAGTGACGTTCCGGACTGGAACTGATTGCTGGTATGCCATGGAAATACGGCCAGTCCATGACCAGGGGGG
GCTTGTTCGCTCAATGGTGGTTGCGGACAACGGTGAATTACTTAGTGAGGGAGGAGTCCCCGGAATAGTG
GCATTGTTTGTGGTCCTTGAATACATCATCCGTAGGAGGCCCTCCACGGGAACGACGGTTGTGTGGGGGG
GTATCGTCGTTCTCGCTCTGCTTGTCACCGGGATGGTCAGGATAGAGAGCCTGGTGCGCTATGTGGTGGC
AGTGGGGATCACATTCCACCTTGAGCTGGGGCCAGAGATCGTGGCCTTGATGCTACTCCAGGCTGTGTTT
GAGCTGAGGGTGGGTTTGCTCAGCGCATTTGCATTGCGCAGAAGCCTCACCGTCCGAGAGATGGTGACCA
CCTACTTTCTTTTGCTGGTCCTGGAATTGGGGCTGCCGGGTGCGAGCCTTGAGGAGTTCTGGAAATGGGG
TGATGCACTGGCCATGGGGGCGCTGATATTCAGGGCTTGCACGGCAGAAGGAAAGACTGGAGCGGGGCTT
TTGCTCATGGCTCTCATGACACAGCAGGATGTGGTGACTGTGCACCATGGACTGGTGTGCTTCCTAAGTG
TAGCTTCGGCATGCTCGGTCTGGAGGCTGCTCAAGGGACACAGAGAGCAGAAGGGATTGACCTGGGTTGT
CCCCCTGGCTGGGTTGCTTGGGGGAGAGGGCTCTGGAATCAGACTGCTGGCGTTTTGGGAGTTGTCAGCG
CACAGAGGAAGACGATCTTTCAGTGAACCACTAACTGTGGTAGGAGTCATGCTAACACTGGCCAGCGGCA
TGATGCGACACACTTCCCAGGAGGCTCTCTGTGCACTCGCAGTGGCCTCGTTTCTCTTGCTGATGCTGGT
GCTGGGGACAAGAAAGATGCAGCTGGTTGCCGAATGGAGTGGCTGCGTTGAATGGTATCCGGAACTAGTG
AATGAGGGTGGAGAGGTTAGCCTGCGGGTCCGGCAGGACGCGATGGGTAACTTTCACTTGACTGAGCTCG
AGAAAGAAGAGAGAATGATGGCTTTTTGGCTGATTGCCGGCTTGGCAGCTTCGGCCATTCACTGGTCAGG
CATTCTTGGTGTGATGGGACTGTGGACGCTCACGGAAATGCTGAGGTCATCCCGAAGGTCTGACCTGGTT
TTCTCTGGACAGGGGGGTCGAGAGCGTGGTGACAGACCTTTCGAGGTTAAGGACGGTGTCTACAGGATTT
TTAGCCCCGGCTTGTTCTGGGGTCAGAACCAGGTGGGAGTTGGCTACGGTTCCAAGGGTGTCTTGCACAC
GATGTGGCACGTGACGAGAGGAGCGGCGCTGTCTATTGATGACGCTGTGGCCGGTCCCTACTGGGCTGAT
GTGAGGGAAGATGTCGTGTGTTACGGAGGAGCCTGGAGCCTGGAGGAAAAATGGAAAGGTGAAACAGTAC
AGGTCCATGCCTTCCCACCGGGGAGGGCGCATGAGGTGCATCAGTGCCAGCCTGGGGAGTTGATCCTTGA
CACCGGAAGAAAGCTTGGGGCAATACCAATTGATTTGGTGAAAGGAACATCAGGCAGCCCCATTCTCAAC
GCCCAGGGAGTGGTTGTGGGGCTATACGGAAATGGCCTAAAAACTAATGAGACCTACGTCAGCAGCATTG
CTCAAGGGGAAGCGGAGAAGAGTCGCCCCAACCTCCCACAGGCTGTTGTGGGTACGGGCTGGACATCAAA
GGGTCAGATCACAGTGCTGGACATGCACCCAGGCTCGGGGAAGACCCACAGAGTCCTCCCGGAGCTCATT
CGCCAATGCATTGACAGGCGCCTGAGAACGTTGGTGTTGGCTCCAACTCGTGTGGTACTCAAAGAAATGG
AGCGTGCTTTGAATGGGAAACGGGTCAGGTTCCACTCACCAGCAGTCAGTGACCAACAGGCTGGAGGGGC
AATTGTCGATGTGATGTGTCACGCAACCTATGTCAACAGAAGGCTACTCCCACAGGGAAGACAAAATTGG
GAGGTGGCAATCATGGATGAGGCCCACTGGACGGACCCCCACAGCATAGCTGCCAGAGGTCATTTGTATA
CTCTGGCAAAAGAAAACAAGTGTGCACTGGTCTTGATGACAGCGACACCTCCTGGTAAGAGTGAACCCTT
TCCGGAGTCCAATGGAGCCATTACTAGTGAGGAAAGACAGATTCCTGATGGGGAGTGGCGTGACGGGTTT
GACTGGATCACTGAGTATGAAGGGCGCACCGCCTGGTTTGTCCCTTCGATTGCAAAAGGTGGTGCTATAG
CTCGCACCTTGAGACAGAAGGGGAAAAGTGTGATTTGTTTGAACAGCAAAACCTTTGAAAAGGACTACTC
CAGAGTGAGGGATGAGAAGCCTGACTTTGTGGTGACGACTGATATCTCGGAGATGGGAGCTAACCTTGAC
GTGAGCCGCGTCATAGATGGGAGGACAAACATCAAGCCCGAGGAGGTTGATGGGAAAGTCGAGCTCACCG
GGACCAGGCGAGTGACCACGGCTTCCGCTGCCCAACGGCGCGGAAGAGTTGGTCGGCAAGACGGACGAAC
AGATGAATACATATACTCTGGACAGTGTGATGATGATGACAGTGGATTAGTGCAATGGAAAGAGGCGCAA
ATACTTCTTGACAACATAACAACCTTGCGGGGGCCCGTGGCCACCTTCTATGGACCAGAACAGGACAAGA
TGCCGGAGGTGGCCGGTCACTTTCGACTCACTGAAGAGAAAAGAAAGCACTTCCGACATCTTCTCACCCA
TTGTGACTTCACACCGTGGCTGGCATGGCACGTCGCAGCGAATGTATCCAGCGTCACGGATCGAAGCTGG
ACATGGGAAGGGCCGGAGGCAAATGCCGTGGATGAGGCCAGTGGTGACTTGGTCACCTTTAGGAGCCCGA
ATGGGGCGGAGAGAACTCTCAGGCCGGTGTGGAAGGACGCACGTATGTTCAAAGAGGGACGTGACATCAA
AGAGTTCGTGGCGTACGCGTCTGGGCGTCGCAGCTTCGGAGATGTTCTGACAGGAATGTCGGGAGTTCCT
GAGCTCCTGCGGCACAGATGCGTCAGTGCCCTGGATGTCTTCTACACGCTTATGCATGAGGAACCTGGCA
GCAGGGCAATGAGAATGGCGGAGAGAGATGCCCCAGAGGCCTTTCTGACTATGGTTGAGATGATGGTGCT
GGGTTTGGCAACCCTGGGTGTCATCTGGTGCTTCGTCGTCCGGACTTCAATCAGCCGCATGATGCTGGGC
ACGCTGGTCCTGCTGGCCTCCTTGCTACTCTTGTGGGCAGGTGGCGTCGGCTATGGGAACATGGCTGGAG
TGGCTCTCATCTTTTACACGTTGCTGACGGTGCTGCAGCCTGAGGCGGGAAAACAGAGAAGCAGTGACGA
CAACAAACTGGCATATTTCTTGCTGACGCTCTGCAGCCTTGCTGGACTGGTTGCAGCCAATGAGATGGGC
TTTCTGGAGAAGACCAAGGCAGACTTGTCCACGGCGCTGTGGAGTGAACGGGAGGAACCCCGGCCATGGA
GTGAATGGACGAATGTGGACATCCAGCCAGCGAGGTCCTGGGGGACCTATGTGCTGGTGGTGTCTCTGTT
CACACCTTACATCATCCACCAACTGCAGACCAAAATCCAACAACTTGTCAACAGTGCCGTGGCATCTGGT
GCACAGGCCATGAGAGACCTTGGGGGAGGTGCCCCCTTCTTTGGTGTGGCGGGACATGTCATGACCCTCG
GGGTGGTGTCACTGATTGGGGCTACTCCCACCTCACTGATGGTGGGCGTTGGCTTGGCGGCACTCCATCT
GGCCATTGTGGTGTCTGGTCTGGAGGCTGAATTAACACAGAGAGCTCATAAGGTCTTTTTCTCTGCAATG
GTGCGCAACCCCATGGTGGATGGGGATGTCATCAACCCATTCGGGGAGGGGGAGGCAAAACCTGCTCTAT
ATGAAAGGAAAATGAGTCTGGTGTTGGCCACAGTGTTGTGCCTCATGTCGGTGGTCATGAACCGAACGGT
GGCCTCCATAACAGAGGCTTCAGCAGTGGGACTGGCAGCAGCGGGACAGCTGCTTAGACCGGAGGCTGAC
ACGTTGTGGACGATGCCGGTTGCTTGTGGCATGAGTGGTGTGGTCAGGGGTAGCCTGTGGGGGTTTTTGC
CTCTTGGGCATAGACTCTGGCTTCGAGCCTCTGGGGGTAGGCGTGGTGGTTCTGAGGGAGACACGCTTGG
AGATCTCTGGAAGCGGAGGCTGAACAACTGCACGAGGGAGGAATTCTTTGTGTACAGGCGCACCGGCATC
CTGGAGACGGAACGTGACAAGGCTAGAGAGTTGCTCAGAAGAGGAGAGACCAATGTGGGATTGGCTGTCT
CTCGGGGCACGGCAAAGCTTGCCTGGCTTGAGGAACGCGGATATGCCACCCTCAAGGGAGAGGTGGTAGA
TCTTGGATGTGGAAGGGGCGGCTGGTCCTATTATGCGGCATCCCGACCGGCAGTCATGAGTGTCAGGGCA
TATACCATTGGTGGAAAAGGGCACGAGGCTCCAAAGATGGTAACAAGCCTGGGTTGGAACTTGATTAAAT
TCAGATCAGGAATGGACGTGTTCAGCATGCAGCCACACCGGGCTGACACTGTCATGTGTGACATCGGAGA
GAGCAGCCCAGATGCCGCTGTGGAGGGTGAGAGGACAAGGAAAGTGATACTGCTCATGGAGCAATGGAAA
AACAGGAACCCCACGGCTGCCTGTGTGTTCAAGGTGCTGGCCCCATATCGCCCAGAAGTGATAGAGGCAC
TGCACAGATTCCAACTGCAATGGGGGGGGGGTCTGGTGAGGACCCCTTTTTCAAGGAACTCCACCCATGA
GATGTATTACTCAACAGCCGTCACTGGGAACATAGTGAACTCCGTCAATGTACAGTCGAGGAAACTTTTG
GCTCGGTTTGGAGACCAGAGAGGGCCAACCAAGGTGCCTGAACTCGACCTGGGAGTTGGAACGAGGTGTG
TGGTCTTAGCTGAGGACAAGGTGAAAGAACAAGACGTACAAGAGAGGATCAGAGCGTTGCGGGAGCAATA
CAGCGAAACCTGGCATATGGACGAGGAACACCCGTACCGGACATGGCAGTACTGGGGCAGCTACCGCACG
GCACCAACCGGCTCGGCGGCGTCACTGATCAATGGGGTTGTGAAACTTCTCAGCTGGCCATGGAACGCAC
GGGAAGATGTGGTGCGCATGGCTATGACTGACACAACGGCTTTCGGACAGCAGAGAGTGTTCAAAGATAA
AGTTGACACAAAGGCACAGGAGCCTCAGCCCGGTACAAGAGTCATCATGAGAGCTGTAAATGATTGGATT
TTGGAACGACTGGCGCAGAAAAGCAAACCGCGCATGTGCAGCAGGGAAGAATTCATAGCAAAAGTGAAAT
CAAATGCAGCCTTGGGAGCTTGGTCAGATGAGCAAAACAGATGGGCAAGTGCAAGAGAGGCTGTAGAGGA
TCCTGCATTCTGGCGCCTCGTGGATGAAGAGAGAGAAAGGCACCTCATGGGGAGATGTGCGCACTGCGTG
TACAACATGATGGGCAAGAGAGAAAAGAAACTGGGAGAGTTCGGAGTGGCGAAAGGAAGTCGGGCCATTT
GGTACATGTGGCTGGGGAGTCGCTTTTTGGAGTTCGAGGCTCTTGGATTCTTGAATGAAGACCATTGGGC
CTCTAGAGAGTCCAGTGGAGCTGGAGTTGAGGGAATAAGCTTGAACTACCTGGGCTGGCACCTCAAGAAG
TTGTCAACCCTGAATGGAGGACTCTTCTATGCAGATGACACAGCTGGCTGGGACACGAAAGTTACCAATG
CAGACTTAGAGGATGAAGAACAGATCCTACGGTACATGGAGGGTGAGCACAAACAATTGGCAACCACAAT
AATGCAAAAAGCATACCATGCCAAAGTCGTGAAGGTCGCGAGGCCTTCCCGTGATGGAGGCTGCATCATG
GATGTCATCACAAGAAGAGACCAAAGAGGTTCGGGTCAGGTTGTGACCTATGCCCTTAACACCCTCACCA
ACATAAAGGTGCAATTAATCCGAATGATGGAAGGGGAAGGGGTCATAGAGGCAGCGGATGCACACAACCC
GAGACTGCTTCGAGTGGAGCGCTGGCTGAAAGAACACGGAGAAGAGCGTCTTGGAAGAATGCTCGTCAGT
GGTGACGATTGTGTGGTGAGGCCCTTGGATGACAGATTTGGCAAAGCACTTTACTTTCTGAATGACATGG
CCAAGACCAGGAAGGACATTGGGGAATGGGAGCACTCAGCCGGCTTTTCAAGCTGGGAGGAGGTACCCTT
TTGTTCACACCATTTCCACGAGCTAGTGATGAAGGATGGACGCACCCTGGTGGTGCCGTGCCGAGACCAA
GATGAACTCGTTGGGAGGGCGCGCATCTCACCGGGGTGCGGCTGGAGTGTCCGCGAGACGGCCTGCCTTT
CAAAAGCCTACGGGCAGATGTGGCTGCTGAGCTACTTCCACCGACGAGACCTGAGGACGCTCGGGCTTGC
CATTAACTCAGCAGTGCCTGCCGATTGGGTTCCTACCGGCCGCACGACGTGGAGCATTCATGCCAGTGGG
GCCTGGATGACCACAGAAGACATGCTGGACGTTTGGAACCGGGTGTGGATTCTGGACAACCCTTTCATGC
AGAACAAGGAAAGGGTCATGGAGTGGAGGGATGTTCCGTACCTCCCTAAAGCTCAGGACATGTTATGTTC
CTCCCTTGTTGGGAGGAGAGAAAGAGCAGAATGGGCCAAGAACATCTGGGGAGCGGTGGAAAAGGTGAGG
AAGATGATAGGTCCTGAAAAGTTCAAGGACTATCTCTCCTGTATGGACCGCCATGACCTGCACTGGGAGC
TCAGACTGGAGAGCTCAATAATCTA

Protein Sequence
>NP_043135.1 polyprotein [Tick-borne encephalitis virus]
MVKKAILKGKGGGPPRRVSKETATKTRQPRVQMPNGLVLMRMMGILWHAVAGTARNPVLKAFWNSVPLKQ
ATAALRKIKRTVSALMVGLQKRGKRRSATDWMSWLLVITLLGMTLAATVRKERDGSTVIRAEGKDAATQV
RVENGTCVILATDMGSWCDDSLSYECVTIDQGEEPVDVDCFCRNVDGVYLEYGRCGKQEGSRTRRSVLIP
SHAQGELTGRGHKWLEGDSLRTHLTRVEGWVWKNKLLALAMVTVVWLTLESVVTRVAVLVVLLCLAPVYA
SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKV
AARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYT
VKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLP
TAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTK
YHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSP
DVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGRVFQKTKKGIERLTVIGEHA
WDFGSAGGFLSSIGKAVHTVLGGAFNSIFGGVGFLPKLLLGVALAWLGLNMRNPTMSMSFLLAGGLVLAM
TLGVGADVGCAVDTERMELRCGEGLVVWREVSEWYDNYAYYPETPGALASAIKETFEEGSCGVVPQNRLE
MAMWRSSVTELNLALAEGEANLTVVVDKFDPTDYRGGVPGLLKKGKDIKVSWKSWGHSMIWSIPEAPRRF
MVGTEGQSECPLERRKTGVFTVAEFGVGLRTKVFLDFRQEPTHECDTGVMGAAVKNGMAIHTDQSLWMRS
MKNDTGTYIVELLVTDLRNCSWPASHTIDNADVVDSELFLPASLAGPRSWYNRIPGYSEQVKGPWKYTPI
RVIREECPGTTVTINAKCDKRGASVRSTTESGKVIPEWCCRACTMPPVTFRTGTDCWYAMEIRPVHDQGG
LVRSMVVADNGELLSEGGVPGIVALFVVLEYIIRRRPSTGTTVVWGGIVVLALLVTGMVRIESLVRYVVA
VGITFHLELGPEIVALMLLQAVFELRVGLLSAFALRRSLTVREMVTTYFLLLVLELGLPGASLEEFWKWG
DALAMGALIFRACTAEGKTGAGLLLMALMTQQDVVTVHHGLVCFLSVASACSVWRLLKGHREQKGLTWVV
PLAGLLGGEGSGIRLLAFWELSAHRGRRSFSEPLTVVGVMLTLASGMMRHTSQEALCALAVASFLLLMLV
LGTRKMQLVAEWSGCVEWYPELVNEGGEVSLRVRQDAMGNFHLTELEKEERMMAFWLIAGLAASAIHWSG
ILGVMGLWTLTEMLRSSRRSDLVFSGQGGRERGDRPFEVKDGVYRIFSPGLFWGQNQVGVGYGSKGVLHT
MWHVTRGAALSIDDAVAGPYWADVREDVVCYGGAWSLEEKWKGETVQVHAFPPGRAHEVHQCQPGELILD
TGRKLGAIPIDLVKGTSGSPILNAQGVVVGLYGNGLKTNETYVSSIAQGEAEKSRPNLPQAVVGTGWTSK
GQITVLDMHPGSGKTHRVLPELIRQCIDRRLRTLVLAPTRVVLKEMERALNGKRVRFHSPAVSDQQAGGA
IVDVMCHATYVNRRLLPQGRQNWEVAIMDEAHWTDPHSIAARGHLYTLAKENKCALVLMTATPPGKSEPF
PESNGAITSEERQIPDGEWRDGFDWITEYEGRTAWFVPSIAKGGAIARTLRQKGKSVICLNSKTFEKDYS
RVRDEKPDFVVTTDISEMGANLDVSRVIDGRTNIKPEEVDGKVELTGTRRVTTASAAQRRGRVGRQDGRT
DEYIYSGQCDDDDSGLVQWKEAQILLDNITTLRGPVATFYGPEQDKMPEVAGHFRLTEEKRKHFRHLLTH
CDFTPWLAWHVAANVSSVTDRSWTWEGPEANAVDEASGDLVTFRSPNGAERTLRPVWKDARMFKEGRDIK
EFVAYASGRRSFGDVLTGMSGVPELLRHRCVSALDVFYTLMHEEPGSRAMRMAERDAPEAFLTMVEMMVL
GLATLGVIWCFVVRTSISRMMLGTLVLLASLLLLWAGGVGYGNMAGVALIFYTLLTVLQPEAGKQRSSDD
NKLAYFLLTLCSLAGLVAANEMGFLEKTKADLSTALWSEREEPRPWSEWTNVDIQPARSWGTYVLVVSLF
TPYIIHQLQTKIQQLVNSAVASGAQAMRDLGGGAPFFGVAGHVMTLGVVSLIGATPTSLMVGVGLAALHL
AIVVSGLEAELTQRAHKVFFSAMVRNPMVDGDVINPFGEGEAKPALYERKMSLVLATVLCLMSVVMNRTV
ASITEASAVGLAAAGQLLRPEADTLWTMPVACGMSGVVRGSLWGFLPLGHRLWLRASGGRRGGSEGDTLG
DLWKRRLNNCTREEFFVYRRTGILETERDKARELLRRGETNVGLAVSRGTAKLAWLEERGYATLKGEVVD
LGCGRGGWSYYAASRPAVMSVRAYTIGGKGHEAPKMVTSLGWNLIKFRSGMDVFSMQPHRADTVMCDIGE
SSPDAAVEGERTRKVILLMEQWKNRNPTAACVFKVLAPYRPEVIEALHRFQLQWGGGLVRTPFSRNSTHE
MYYSTAVTGNIVNSVNVQSRKLLARFGDQRGPTKVPELDLGVGTRCVVLAEDKVKEQDVQERIRALREQY
SETWHMDEEHPYRTWQYWGSYRTAPTGSAASLINGVVKLLSWPWNAREDVVRMAMTDTTAFGQQRVFKDK
VDTKAQEPQPGTRVIMRAVNDWILERLAQKSKPRMCSREEFIAKVKSNAALGAWSDEQNRWASAREAVED
PAFWRLVDEERERHLMGRCAHCVYNMMGKREKKLGEFGVAKGSRAIWYMWLGSRFLEFEALGFLNEDHWA
SRESSGAGVEGISLNYLGWHLKKLSTLNGGLFYADDTAGWDTKVTNADLEDEEQILRYMEGEHKQLATTI
MQKAYHAKVVKVARPSRDGGCIMDVITRRDQRGSGQVVTYALNTLTNIKVQLIRMMEGEGVIEAADAHNP
RLLRVERWLKEHGEERLGRMLVSGDDCVVRPLDDRFGKALYFLNDMAKTRKDIGEWEHSAGFSSWEEVPF
CSHHFHELVMKDGRTLVVPCRDQDELVGRARISPGCGWSVRETACLSKAYGQMWLLSYFHRRDLRTLGLA
INSAVPADWVPTGRTTWSIHASGAWMTTEDMLDVWNRVWILDNPFMQNKERVMEWRDVPYLPKAQDMLCS
SLVGRRERAEWAKNIWGAVEKVRKMIGPEKFKDYLSCMDRHDLHWELRLESSII

Molecule Role Protective antigen
Molecule Role Annotation Series of plasmid constructs encoding different forms of the envelope glycoprotein E of the flavivirus tick-borne encephalitis virus were constructed. These included a secreted recombinant subviral particle, a secreted carboxyl-terminally truncated soluble homodimer, a nonsecreted full-length form, and an inefficiently secreted truncated form. Mice were immunized using both i.m. injection and Gene Gun-mediated application of plasmids. The functional immune response was evaluated by determining specific neutralizing and hemagglutination-inhibiting Ab activities and by challenging the mice with a lethal dose of the virus.The plasmid construct encoding a secreted subviral particle, which carries multiple copies of the protective Ag on its surface, was superior to the other constructs in terms of extent and functionality of the Ab response as well as protection against virus challenge (Aberle et al., 1999).
Related Vaccines(s) TBEV DNA vaccine encoding E protein
References