VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

gp50

Gene Name gp50
Sequence Strain (Species/Organism) Suid herpesvirus 1
VO ID VO_0011248
NCBI Protein GI 2440155
Other Database IDs CDD:279830
InterPro: IPR002896
UniProtKB/TrEMBL: O41201
Taxonomy ID 10345
Gene Strand (Orientation) ?
Protein Name glycoprotein gp50
Protein pI 5.27
Protein Weight 25087.4
Protein Length 307
Protein Note isolated from camels
Protein Sequence
>CAA75105.1 glycoprotein gp50, partial [Suid alphaherpesvirus 1]
MLLAALLAALVARTTLGADVDAVPAPTLPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPPEDPCGVVA
LISDPQVDRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQIFGRCRRRTTPMWWTPSAD
YMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQHRTYKFGACWSDDS
FNGGVDVMRFLTPFYQQPPHREVVNYW

Molecule Role Protective antigen
Molecule Role Annotation A NYVAC vaccinia vector containing genes for pseudorables virus glycoproteins gII and gp50 was administered to pigs to determine if it would have a greater protective effect than a vector containing the gene for gp50 alone. Both NYVAC vectors protected pigs similarly from virulent pseudorabies virus challenge (Brockmeier and Mengeling, 1996).
Related Vaccines(s) Pseudorabies recombinant vector vaccine encoding gp50 and gII protein , Pseudorabies recombinant vector vaccine encoding gp50 protein
References