VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GII

Gene Name GII
Sequence Strain (Species/Organism) Suid herpesvirus 1
VO ID VO_0011249
NCBI Protein GI 1335775
Other Database IDs CDD:223014
Taxonomy ID 10345
Gene Strand (Orientation) ?
Protein Name glycoprotein gII
Protein pI 11.38
Protein Weight 14546.78
Protein Length 200
Protein Note glycoprotein BALF4; Provisional
Protein Sequence
>AAB26946.1 glycoprotein gII, partial [Suid alphaherpesvirus 1]
PFGALAIGLLVLAGLVAAFLAYRHISRLRRNPMKALYPVTTKALKEDGVEEGDVDEAKLDQARDMIRYMS
IVSALEQQEHRRARRTAGPRSWPAGSGRWLRAAGTTSASRARTPTPCSPLPRETIKMRLFGNT

Molecule Role Protective antigen
Molecule Role Annotation A NYVAC vaccinia vector containing genes for pseudorables virus glycoproteins gII and gp50 was administered to pigs to determine if it would have a greater protective effect than a vector containing the gene for gp50 alone. Both NYVAC vectors protected pigs similarly from virulent pseudorabies virus challenge (Brockmeier and Mengeling, 1996).
Related Vaccines(s) NYVAC-PRV- gII/ gp50 , Pseudorabies recombinant vector vaccine encoding gp50 and gII protein
References