VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

A21L

Gene Name A21L
Sequence Strain (Species/Organism) Vaccinia virus
VO ID VO_0012363
NCBI Gene ID 3707670
NCBI Protein GI 66275937
Locus Tag VACWR140
Genbank Accession AY603355
Protein Accession YP_233022
Taxonomy ID 10245
Gene Starting Position 127904
Gene Ending Position 128257
Gene Strand (Orientation) -
Protein Name IMV membrane protein
Protein pI 8.71
Protein Weight 12850.65
Protein Length 117
Protein Note IMV membrane protein; similar to vaccinia virus strain Copenhagen A21L; The poxviridae are enveloped unsegmented dsDNA viruses; unlike many dsDNA viruses that replicate in the host nucleus poxviruses encode their own replication machinery and therefore replicate in the cytoplasm; viral genes are expressed in a bi-phasic manner with early genes encoding non-structural proteins involved in genome replication and late genes encoding the viral structural proteins
DNA Sequence
>NC_006998.1:127904-128257 Vaccinia virus, complete genome
TTTAGGTAGTAAAAAATAAGTCAGAATATGCCCTATAACACGATCGTGCAAAACCTGGTATATCGTCTCT
ATCTTTATCACAATATAGTGTATCGACATCTTTATTATTATTGACCTCGTTTATCTTGGAACATGGAATG
GGAACATTTTTGTTATCAACGGCCACCTTTGCCTTAATTCCAGATGTTGTAAAATTATAACTAAACAGTC
TATCATCGACACAAATGAAATTCTTGTTTAGACGTTTGTAGTTTACGTATGCGGCTCGTTCGCGTCTCAT
TTTTTCAGATATTGCAGGTACTATAATATTAAAAATAAGAATGAAATAACATAGGATTAAAAATAAAGTT
ATCA

Protein Sequence
>YP_233022.1 Membrane protein [Vaccinia virus]
MITLFLILCYFILIFNIIVPAISEKMRRERAAYVNYKRLNKNFICVDDRLFSYNFTTSGIKAKVAVDNKN
VPIPCSKINEVNNNKDVDTLYCDKDRDDIPGFARSCYRAYSDLFFTT

Molecule Role Protective antigen
Related Vaccines(s) LC16m8
References